KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00020336G001
Entry
GSTEN00020336G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K10147  protein phosphatase 1D [EC:3.1.3.16]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:tng00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    GSTEN00020336G001
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:tng01009]
    GSTEN00020336G001
Enzymes [BR:tng01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     GSTEN00020336G001
Protein phosphatases and associated proteins [BR:tng01009]
 Protein serine/threonine phosphatases
  Mg2+- or Mn2+- dependent protein phosphatases (PPMs)
   PPM1 phosphatases (PP2C)
    GSTEN00020336G001
SSDB
Motif
Pfam: PP2C PP2C_2
Other DBs
NCBI-ProteinID: CAG01541
UniProt: Q4SCU1
LinkDB
Position
7
AA seq 487 aa
MEDAIVFRMSAFSDQGGRKYMEDVVEIKIEYEPTQPTVEDDLKSQRHGGEDKADNPLTKQ
VETETQDSDGTAEAGPVSAVWVEDLTSEDNGKDGAPVSGEKVSNHTVNTQKSVAFFAVFD
GHGGREAAHFAREHLWDLLKRQRGFWSRDPSEVCAALRKGFIACHHAMWKELPEWPKTIT
GLPSTSGTTASVIVIRGVHMYVAHVGDSAVVVGVRENDSDIRLQALEITQDHKPELPKEK
ERIERLGGSVMKKSGVNRVVWKRPRLTHNGPVRRSTVIDQIPFLAVARSLGDLWSYDFYS
GEFVVSPEPDTMVLTLDPKRHRYIILGSDGLWNMMPPKNAVNMCYSHDKMVWSDVPSPFK
DCSTSLEESFGGRCEAAFCAPAQLLPDAESVRTALPASDTSVNVFEKQVSTAEVERDISA
PPAKKSRHCPHTPPELRGPHLQPHLSSERVPAEAQDELASQKAAEMGESSSSEEQGILPQ
HSALCVC
NT seq 1464 nt   +upstreamnt  +downstreamnt
atggaagatgcaatagtgtttcgtatgagtgcgttttcggaccaaggtggaagaaaatac
atggaggatgttgtcgagataaaaatcgaatacgagcccacacagccgacggtcgaagat
gatctaaagtcacagagacatggaggagaggataaagccgacaacccgctgactaaacag
gttgaaaccgagacacaggacagtgacggtaccgctgaagcaggaccggtgtctgccgtc
tgggtagaagatctaaccagcgaggacaatggcaaagacggcgcaccggtgtcaggcgaa
aaagtctccaaccacacagtcaacactcagaagtcagtggcgttttttgctgtatttgat
ggtcacggtggtcgagaagcagcacatttcgcccgcgaacatctgtgggatctgctgaag
aggcagcggggcttttggtcccgagatcccagcgaggtgtgcgcagccctccggaaaggc
ttcatcgcctgtcaccatgcgatgtggaaagagctaccggagtggccgaagacaatcacc
ggtttacccagtacgtccggcaccacagccagtgtgatcgtgatccgaggagttcacatg
tacgtcgctcacgttggggattcggccgttgtggttggagtgagagagaatgactctgac
atcagactccaggcgctggaaatcacacaagaccacaaaccagaactccccaaagagaag
gagcgcattgaaagactgggtggcagcgtcatgaaaaagtctggtgtgaaccgtgtcgtg
tggaaaagacccaggttgacccacaatggtccggtgaggaggagcacagtcatcgatcag
atccccttcctggccgtggccagatctcttggagacttgtggagctacgacttctacagt
ggcgagtttgtggtttctccggagcctgataccatggtgttaacgcttgaccccaaacga
catcgctacatcatccttggcagcgatgggttatggaatatgatgcctcctaagaatgcc
gtcaacatgtgttacagccatgacaaaatggtgtggagtgatgttccctcaccattcaaa
gactgttctacatctctggaggaatcgtttgggggacggtgtgaagcagctttctgtgca
ccggcacagctcttacctgatgctgaatctgtgaggaccgcgctgcctgcatctgacact
tctgtgaatgttttcgaaaaacaagtctccacagcagaggtggagcgtgacatttccgct
ccgccagcaaaaaagagccgccattgtccgcacacaccccctgaactcagggggccccac
cttcagccacacctgtcctcagaaagagtcccagcagaggcgcaggatgagctagccagt
cagaaagctgctgaaatgggtgaaagcagctcctctgaagagcaaggtatcctgccacag
cactctgccttgtgtgtgtgctaa

KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00026869G001
Entry
GSTEN00026869G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K10147  protein phosphatase 1D [EC:3.1.3.16]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:tng00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    GSTEN00026869G001
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:tng01009]
    GSTEN00026869G001
Enzymes [BR:tng01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     GSTEN00026869G001
Protein phosphatases and associated proteins [BR:tng01009]
 Protein serine/threonine phosphatases
  Mg2+- or Mn2+- dependent protein phosphatases (PPMs)
   PPM1 phosphatases (PP2C)
    GSTEN00026869G001
SSDB
Motif
Pfam: PP2C PP2C_2
Other DBs
NCBI-ProteinID: CAG06503
UniProt: Q4RYM9
LinkDB
Position
16
AA seq 451 aa
LRVSVFTDQGGRKYMEDVTEVIVEPEPGEDEPKSDEPGDSSAVEFMTSSATEDKHDRQTR
KTDSSSFVSDAPYETVQTENEGTTAGNAVCGGRSPPPPEPSAAGRSRRSVAFFAVFDGHG
GCEAAQFARDYLWEFVKKQRGFWSDCDREVCSALRKGFVACHHAMWKKLPEWPKTLTGLP
STSGTTASIVVIRGDRMYVAHVGDSAVVLGVQDDPSLPFIRAVEVTQDHKPELPRERERI
EGLGGSVIKKSGVNRVVWKRPRLSHNGPVRRSTVIDQIPFLAVARALGDLWSYDFYSGEF
VVSPEPDTSVVTLDPKKHRYIVLGSDGLWNMVPPQEAISMCQNNDEAMVSEARTSSCPQK
KRVIVFDSYKIIGPYRRHVGCQTLGSWSATPCCGGARGCCVPTTQALLSLACRSLGASRT
TCTRRRCCWTYPRCPSVPPPFCHVPTLLSFR
NT seq 1356 nt   +upstreamnt  +downstreamnt
ctacgagtgagcgtttttactgaccaagggggaaggaaatacatggaagatgtgaccgag
gtcatagtggaacctgagccgggagaagacgagccaaagtcggatgagccgggggatagc
agtgcggtagagtttatgaccagttctgcgactgaggacaagcatgataggcagactaga
aaaaccgacagctcctctttcgtatcagatgcaccatatgaaaccgtgcaaacggaaaat
gaaggtactacagcgggaaacgctgtttgtggaggtcggagcccgccgccgccggagccc
agcgccgccggtcgttcgcgccggtctgtggcattcttcgccgtgttcgatggacacggg
ggttgcgaagccgcgcagtttgcacgggactatttgtgggagtttgtgaagaagcagcgg
ggcttctggtcggactgcgatcgagaggtttgctcggctttacgcaaaggatttgtagcc
tgtcaccatgctatgtggaagaagctgcctgagtggccaaagacactaacaggccttccg
agcacatcaggcaccaccgccagcatagtggtaatcagaggagatcgcatgtacgtggcc
catgtgggggactctgctgtggttctgggggtccaggatgacccatcgctcccgttcatc
agagctgtggaagtcacacaggaccacaaaccagagctacccagagagagggagcgtatt
gaaggtttgggagggagcgtcatcaagaaatctggagtgaaccgcgttgtctggaagagg
ccgagactcagtcacaacggtccagtccgtcggagcaccgtcatcgaccagataccgttc
ttagcagtagcccgggcgctaggcgatctttggagctatgacttctacagcggggagttt
gtagtgtctcccgagccagacactagcgtagtaaccctcgaccccaagaagcaccgctac
atcgtcctgggaagcgatggtctgtggaacatggtgccacctcaggaggccatctccatg
tgccagaacaatgacgaggcaatggtaagtgaagctcggacaagctcgtgtccccaaaaa
aaacgagtaattgtttttgattcgtacaaaataattggaccctacaggcgccacgtgggg
tgtcaaacgctcggcagctggtcagccacgccctgctgcggtggcgccagaggatgctgc
gtgccgacaacacaagcgctattgtcattggcctgcaggagcctgggagcatccaggaca
acctgcacgaggagacggtgctgctggacttatccaaggtgtcccagtgtccctccacct
ttttgtcacgtgccgacactcctctccttcaggtga

DBGET integrated database retrieval system