KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00020587G001Help
Entry
GSTEN00020587G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng00020  Citrate cycle (TCA cycle)
tng00190  Oxidative phosphorylation
tng01100  Metabolic pathways
tng01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tng00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GSTEN00020587G001
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    GSTEN00020587G001
Enzymes [BR:tng01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     GSTEN00020587G001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_9 Fer4_18 Fer4_7
Motif
Other DBs
NCBI-ProteinID: CAG01723
UniProt: Q4SCA9
LinkDB All DBs
Position
undetermined
AA seq 281 aa AA seqDB search
MSAVYFAFSRNVLAFRNSGALVMVRYAQTAAALAPEPRIKKFQVYRWDPDTPGDKPRMQT
YEIDLNACGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNINGGNTLACLNKIDPN
TNKTTKIYPLPHMYVVKDLVPDMSNFYAQYKSIEPYLKKKDETREGKKQYFQSVEDRQKL
DGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDEFTEERLAKLQDPFSL
YRCHTIMNCTKTCPKGLNPGKAIAEIKKMMATYKEKKAAVS
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcagtttatttcgctttcagtcgaaacgttttggccttcaggaattccggcgca
ctagtcatggtgcgttacgcacagacggccgccgctttggctcctgagccgaggatcaag
aagtttcaggtttaccgatgggaccccgacacccccggcgacaaaccacgaatgcaaaca
tatgaaattgaccttaacgcgtgcggtccaatggttctagatgctctcattaaaatcaag
aacgaaatcgatccaacactcacattcaggcgctcttgtcgtgagggtatctgtggctca
tgtgccatgaacataaacggaggcaacactttggcgtgtctgaacaaaattgaccccaac
acaaataaaacaactaaaatctacccacttccgcacatgtatgtggtcaaagacttggtt
cctgacatgagcaacttctacgcacagtacaaatccattgagccctatctgaagaagaag
gatgaaacccgagaagggaagaagcagtatttccagtcagtggaagaccgacaaaagctg
gacggcctgtacgagtgcatcctctgcgcctgctgcagcaccagctgtcccagctactgg
tggaacggagacaagtacctgggacccgccgtcctcatgcaggcgtatcggtggatgatt
gactcccgcgatgaatttactgaggaacgtctggctaaactccaggatcccttctctctc
taccgctgccacaccatcatgaactgcaccaagacgtgccccaagggactcaacccagga
aaggccatcgcggagatcaaaaaaatgatggctacttacaaagagaagaaagctgcagtg
tca

DBGET integrated database retrieval system