KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00020648G001
Entry
GSTEN00020648G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K04399  caspase 9 [EC:3.4.22.62]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04115  p53 signaling pathway
tng04210  Apoptosis
tng04370  VEGF signaling pathway
tng05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:tng00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    GSTEN00020648G001
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    GSTEN00020648G001
   04115 p53 signaling pathway
    GSTEN00020648G001
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    GSTEN00020648G001
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:tng01009]
    GSTEN00020648G001
   01002 Peptidases and inhibitors [BR:tng01002]
    GSTEN00020648G001
Enzymes [BR:tng01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.62  caspase-9
     GSTEN00020648G001
Protein phosphatases and associated proteins [BR:tng01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     GSTEN00020648G001
Peptidases and inhibitors [BR:tng01002]
 Cysteine peptidases
  Family C14: caspase family
   GSTEN00020648G001
SSDB
Motif
Pfam: Peptidase_C14 CARD CARD_2 MM_CoA_mutase
Other DBs
NCBI-ProteinID: CAG01765
UniProt: Q4SC67
LinkDB
Position
undetermined
AA seq 445 aa
MEERHKKILQRNRINLVSELEPLNLYDGLIEKGVFTHDMIDEIKCSGARRDQARQLVRDL
ETRGSRAFPAFLECLKETGYHSLAELLQNGAPTVQIQPPTPIPVDRPVIQPLPISPPLVP
PEEPVSPVPKPSTPGRASFFLLPFVCQSYRMEANPLGHCLIINNVEFEPKSGLSNRNGSN
VDCDRLERRFKALNFTVKVKTNLKQRQIRQELSALSKVDHSQYDCCVVVILSHGTEVSHS
RFPGAVYGVDGQFVPVQHIATYLNGQYCPSLQGKPKLFFIQACGGDEKDTGFQVSPDEFE
PPVVGADDQTDAIPVSSSSDSLSMSDEPDARASLPTSSDILVSYSTFPGYVSWRDPKAGS
WYVETLDRVLEENAALHDLVVMLTMVGCSYYVDQKSFSHAGSTGSINVPSSAHLQVNDEV
SQNQAKGLYKQMPGSFNFLRKRLYF
NT seq 1335 nt   +upstreamnt  +downstreamnt
atggaggaaagacacaaaaagattcttcagcggaacaggatcaatctcgttagtgaattg
gaacccttaaacctctacgatggcctgatcgaaaagggtgttttcacccacgatatgatc
gatgagataaagtgctctggagccaggcgcgatcaggccagacagctggtccgggatctg
gagacccgaggaagtcgagctttcccagcctttctggagtgtctcaaagaaaccggctac
cattctttggctgaactacttcagaatggagccccaacagttcagatacaacctccgacc
cccattccagtcgatcgtccagtcatccagcctctcccaatttcccctccattggttcct
ccagaggaacctgtcagcccagtcccaaagcccagcaccccaggcagggcatcctttttt
ctgcttccttttgtgtgccagagctatagaatggaggccaaccctttaggacattgccta
attatcaacaacgtggagtttgagcccaagagcgggctgagcaatcggaacggctccaac
gttgactgtgacaggctggagagacgattcaaagcactaaactttactgtgaaggtgaag
actaacctgaaacaaagacaaatcagacaggagctctcggctttgtccaaggtggaccac
tcgcagtatgactgctgcgtggtcgtaatcctgtcccatgggaccgaggtgagccacagc
cgcttccccggtgctgtgtatggtgtggacggacagtttgttcctgtccagcacattgcg
acttacctcaacggccagtattgtccatccttacagggcaaacctaaacttttctttatc
caggcttgtggaggagatgaaaaggacacaggcttccaggtgtccccggatgagtttgag
ccaccggtcgtcggtgctgatgatcagacagacgccattccggtgtcctccagcagtgac
tcgctgagcatgtccgatgagccggacgccagagcatcgctacccacctcgagtgacatt
ctggtgtcctactccacttttcctggttacgtttcttggcgagaccccaaggctggctcc
tggtatgtcgaaactttggatcgcgtgcttgaagagaatgccgctcttcacgacctggtc
gtgatgttgacgatggtgggatgttcttattacgtcgatcagaagagcttcagccatgct
ggttctactggatcaataaacgttccatcatctgctcatttacaggtcaacgacgaagtc
tcccaaaatcaggccaaaggactgtacaaacagatgcccggctcttttaacttcctgcgc
aaacgtctctacttt

DBGET integrated database retrieval system