KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00020796G001
Entry
GSTEN00020796G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K02084  apoptotic protease-activating factor
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04115  p53 signaling pathway
tng04210  Apoptosis
tng05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:tng00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    GSTEN00020796G001
   04115 p53 signaling pathway
    GSTEN00020796G001
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    GSTEN00020796G001
SSDB
Motif
Pfam: WD40 APAF1_C NB-ARC ANAPC4_WD40 CARD Ge1_WD40 eIF2A AAA_16 CARD_2 WD40_like
Other DBs
NCBI-ProteinID: CAG01878
UniProt: Q4SBV4
LinkDB
Position
19
AA seq 1199 aa
MALEERARSCLLRFRHQLEQDIKPSYLMDHMVSDGVLSIDEEDRIRTLPTRRDQAVALLE
LLLKKDNRAYISFYNSLVKVAYNDLATLLFEALPRSASDGCTPYVQTVLSEGGVPQRPVV
FVGRPELVNQIREKLYRLQKGSGWVTVFGMAGSGKSVLAAEAVRHHSLIEGETYLTYLCF
CEQGSINSALSVVFLTFLLTCIFRMFPWRDQLVVHWPIGQTRLAGKDPVLVFPPGAELGI
HSLFIVLPTLLMKLRSVCATLCCADIQGNKYEVEVESGLDENKGLEILALYTDNKPHGLP
EEACSIVRECKGSPLVVSLIGALLKEKPNRWSYYLRQLQQKQFKRIRKSSSYDYDALDQA
MAASIEVLPDEHQELYKDLTVFEKDIKIPAKVLSVLWDLEPEDVEDILEEFVNKSLLFVD
SNHRPYLYYLHDLQLDFLVEQNRTQLERLHTKVVQQYQLHYKDGPPLSGDEECLYWVRFM
TYHMAKAKLSQELYSLMFSLDWVSIKAQIMGPAHLISDYVEYGHILDKENSDVRSQFQEF
LSLNGHQLEQRPFPDVVQLALSQPHASEVYRQALQQAQERASTGKLYFDWLNKNSVESLS
RLVIHPHQGSIYSACFSHDGTKIAASGAYKTLKAYTFPLSEKLTEIQAHDDEVLCCAFSP
DDRLLATCSSDRKVKVWNAERAMLLRVFEEEHEEQVNHCQFTNTMRRLLLVTCSNDEFMN
VKLWNLNKPSSQNTMFGHTEPVNHCCFSPDDTYVSTASNDGTVKLFQVSHANEWKTINVR
KRLTENDEEVLVKCSTWTADGKQLICAARNAVLVFDVETSDLLSEIKTSRLSTVQYCHAC
PTNNLLAIAFSNYAVELWDLEANKKMADCSGHLSWVQLVQFSTDGSQLLSCSDDQTIRLW
ETTKVHTSSAICLKRDSDVLFDQEEIIISAADNCNRLQVRSGKTGSVLFQSEEKSSRIRS
TCLCRNPSAVVIGQENGTVQVLELPTGKVLATLLGHTKTVFWCQFSQCGETLFTSSEDTT
IRVWRWRSGECKTLLGHREQVRHFSLLSSSPSDTRLLSWSFDGTVKMWDTESGEKLQDME
AHQGAILSCHVSPDGCFFATTSADRTAKLWHCESWQCVHTLKGHQECVRSCRFSWDSRRV
ATGDDNGEIRLWSAKDGSLLKICSREGKDGMDSLHGGWVTDLHFSRDNTLLVSTGGYIK
NT seq 3597 nt   +upstreamnt  +downstreamnt
atggcgttggaggaaagagcaaggagctgcctgttgcgctttcgtcaccaattggagcag
gacatcaagccgtcctacctgatggatcacatggtcagtgatggtgtgctcagcatagat
gaagaggacaggatcaggacactgcccaccaggagggatcaagcagtggccctgctggag
cttctgctgaaaaaagacaaccgtgcctatatctcattctacaattccctggttaaagtg
gcatacaatgatttggccacccttcttttcgaggccctaccacgctctgcctctgatgga
tgcacgccctacgtgcagacagtcctcagtgagggaggcgtaccacagaggcctgtggtg
tttgttggcagaccagaacttgtgaatcagatcagggagaaactctaccggctgcagaag
ggatccggttgggtcaccgtctttggcatggctggctccgggaaatctgttttagctgct
gaagctgtcagacatcacagtctgatcgaaggtgaaacatatctgacatatctgtgtttt
tgtgagcagggatccattaattctgctctttcagtagtgtttctgactttcctccttacc
tgcatctttagaatgtttccctggagggatcaattggttgtccattggccaattggacaa
accagacttgctggtaaagatccagtccttgtgtttccgcctggagcagagcttgggatt
cacagtctcttcatcgtcctcccaactctcttgatgaagctaaggagcgtctgcgccacc
ttatgctgcgcagatatccaaggtaataaatatgaagttgaagtggagagtggtctggat
gaaaacaaagggcttgagatcctggcactgtacaccgataataaaccacatggacttcct
gaagaggcctgcagcatcgttagagagtgtaaaggctcacctctggttgtgtccttgatt
ggggccctgctcaaagagaaacccaaccgttggagttactaccttcggcagctgcagcag
aagcagttcaagcgcatcaggaagtcatcctcatacgactatgacgccctcgaccaagca
atggcggctagcatcgaagtgttgcctgatgagcatcaagagctctacaaggatcttaca
gtgtttgagaaggacatcaaaatccctgcaaaggttttgtctgtgctctgggatttggaa
cctgaagatgtggaagacatccttgaggagtttgtcaacaaatcgctgctttttgtggac
agtaatcatagaccttacttgtattatctccatgacctccagctggacttcctagtggaa
cagaatcggacccagcttgagcgccttcatacaaaggtggtgcagcagtaccagctccac
tacaaagatggtccccccctttcaggagacgaggagtgtctttactgggtcagatttatg
acgtatcacatggccaaggctaaactttcacaggagctttactccctcatgttctcactg
gactgggtcagcatcaaagcccaaatcatgggtccagcccaccttatcagtgattatgtg
gagtatggacacattcttgataaagagaacagtgacgtgcgcagtcagttccaggagttt
ttatctctgaatggtcaccagctggagcagcgtccgtttcctgatgtggtgcagctagca
ctgtcccagccacatgcatcagaggtttacaggcaggccctgcagcaggcacaggagcgg
gccagcacaggaaaactctactttgactggctgaataagaattctgtggagagcctgtct
cgtcttgtgatccatccccaccagggctccatctactctgcctgcttctcgcatgatgga
accaagatcgcagccagtggtgcctataagacactgaaggcatatacttttcctttgagt
gagaagctgacagagatccaggcacatgacgacgaggtgctctgctgtgccttctcccct
gatgaccgtctgctagcaacatgctccagtgacagaaaagtcaaggtttggaatgcagag
cgagccatgctcctgagggtttttgaggaagaacacgaagagcaggtcaaccactgccag
ttcaccaacacaatgcggcgtcttctgctggtcacctgctccaatgacgagtttatgaat
gttaagttgtggaacctcaacaagccatcttcccagaacaccatgtttggccacactgag
ccagtaaatcactgctgtttctcgccagatgacacctacgtgtctacagcttctaacgac
ggtacagtcaagctgttccaggtgtcgcacgctaatgagtggaagacaattaacgtgaga
aaaaggcttaccgaaaatgatgaagaggttctggtcaagtgcagcacttggactgctgat
gggaagcaactcatatgcgcagccagaaatgctgttctggtgtttgatgtggaaacatca
gacttgctgtcggagatcaaaacgagccgcctgagcacggtgcagtactgccacgcttgt
ccgaccaataacctactggctattgctttctcaaactacgctgtggagctgtgggattta
gaagccaataagaaaatggctgactgcagtggtcacctcagctgggtccagcttgtccag
ttctcaactgacggctcccagctgctctcctgctccgatgatcaaaccatcaggttatgg
gagactacgaaggtacacacctcctcagccatctgcttaaaacgagactctgatgtgctt
tttgaccaagaggagatcatcatttcagctgcagacaactgcaacaggctgcaggtgcgc
agtggcaagactggatctgtgctcttccagtcagaggagaagtcctctaggatccggtct
acgtgtttgtgtcggaatccctctgctgtggtcatagggcaggaaaatggcaccgtacag
gtactggagctgcctactgggaaggtgttagccactttgctgggacacaccaagacggtc
ttctggtgccagttcagccagtgcggcgaaacacttttcacttcctctgaggacaccacc
attagggtgtggaggtggcggtcgggtgagtgtaaaacactgctgggtcacagggaacaa
gtcaggcacttttcactgctctccagctcaccttctgacacaagattgctgtcttggtcc
tttgatggcaccgtcaagatgtgggacacggaaagtggagaaaagctgcaggatatggag
gctcaccagggggccattctttcctgtcacgtttcgccagacggctgcttcttcgccacc
acctctgctgacaggaccgctaagctgtggcactgtgagtcctggcagtgcgtccacaca
ttaaagggacatcaggaatgcgttcggagctgtcgattttcctgggacagccgacgcgtc
gcgacaggggacgacaacggtgagattcggctctggagtgccaaggatggctccctgctg
aaaatctgctcccgggagggtaaagacggcatggactcgctccacggaggctgggtgaca
gacctgcacttctccagagacaacactcttttggtctccacgggcggctacatcaag

DBGET integrated database retrieval system