KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00021580G001
Entry
GSTEN00021580G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K10144  RING finger and CHY zinc finger domain-containing protein 1 [EC:2.3.2.27]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04115  p53 signaling pathway
tng04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:tng00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    GSTEN00021580G001
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    GSTEN00021580G001
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:tng04121]
    GSTEN00021580G001
Enzymes [BR:tng01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     GSTEN00021580G001
Ubiquitin system [BR:tng04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    GSTEN00021580G001
SSDB
Motif
Pfam: zinc_ribbon_6 zf-CHY zf-RING_2 zf-C3HC4 zf-RING_5 Prok-RING_4 zf-RING_4
Other DBs
NCBI-ProteinID: CAG02458
UniProt: Q4SA74
LinkDB
Position
12
AA seq 242 aa
MASSAGCEHYVRSCLLKAPCCGKLYVCRLCHDAEENHEMDRFKVREVQCSECQTLQQAQQ
TCEQCHVQFGEYYCNICHLFDKDKKQYHCQPCGICRIGPREKYFHCEKCNLCLAQDLHGN
HKCVENVSRQNCPVCMEDIHTSRIEAKVLSCGHLLHKTCFDDMVKMRAYRCPLCMHSVWN
MEKHWEQIGQEIAQTPMPPEYQHATVKIICNDCQAHCTVAFHVLGMKCSSCGSYNTAQYG
GL
NT seq 726 nt   +upstreamnt  +downstreamnt
atggcttcgtctgctggatgtgagcattatgttcgtagctgcctcctgaaagcgccttgc
tgtgggaaactgtatgtctgccggctgtgtcacgatgcagaggagaaccatgaaatggac
cggttcaaagtgcgggaggtgcagtgctccgagtgtcagacactgcagcaggcacagcag
acctgtgagcagtgccatgtacagtttggagaatattactgtaacatttgccacttgttt
gacaaggacaaaaagcagtaccactgtcaaccctgtggaatatgcaggattgggcccagg
gagaaatatttccattgtgagaaatgcaacttgtgtttagcccaggacctacacgggaac
cacaagtgtgtggagaatgtgtcaaggcagaactgcccagtctgcatggaggatatccac
acatccagaattgaggctaaggtcctttcatgtggtcaccttttacacaagacttgcttt
gacgacatggtcaaaatgcgtgcatatcgctgtcctctgtgcatgcactcggtctggaac
atggaaaaacattgggaacaaataggtcaagagattgcccaaacaccgatgccgcctgaa
taccagcatgcaacagtcaagattatatgcaatgactgccaggcccactgcaccgtggct
ttccacgtgctggggatgaagtgcagcagctgcggctcctacaacactgcgcagtacgga
ggcctg

DBGET integrated database retrieval system