KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00021756G001Help
Entry
GSTEN00021756G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K06588  integrin beta 5
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04145  Phagosome
tng04510  Focal adhesion
tng04512  ECM-receptor interaction
tng04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:tng00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    GSTEN00021756G001
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    GSTEN00021756G001
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    GSTEN00021756G001
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    GSTEN00021756G001
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tng04131]
    GSTEN00021756G001
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:tng04515]
    GSTEN00021756G001
Membrane trafficking [BR:tng04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    GSTEN00021756G001
Cell adhesion molecules [BR:tng04515]
 Integrins
  Integrin beta subunits
   GSTEN00021756G001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_beta Integrin_B_tail EGF_2 I-EGF_1 PSI_integrin Integrin_b_cyt
Motif
Other DBs
NCBI-ProteinID: CAG02605
UniProt: Q4S9S7
LinkDB All DBs
Position
2
AA seq 823 aa AA seqDB search
GLNICTGGSATSCQECLLIHPSCAWCAQDVRLPNLALVIKSQPIVFGVSEVPANANIRIY
LSFQDFGQRKTLTSRCDFEQNLVKRGCDQRFVESPSSSISVLQNVPLSSKGVSQYDVVQI
MPQKMALSLRPGRCPVREDWCLFPEKPEIKAAKMVSKRLLRVFAPSGGQTWFQLQVRQVE
DYPVDLYYLMDLSLSMKDDLDTIRNLGTKLAYEMGKLTSNFRLGFGSFVDKNMSPFSYTA
EKYRENPCNGYKPFPNCVPTFGFRHILPLTDKVDSFNVEVQKQMVSRNRDAPEGGFDAIL
QAAVCKEKIGWRKEAYHLLVFATDDVPHLALDGRLGGLVEPHDGQCHLDDGSEYSASTKM
DYPSLALLGEKLAENNIFLIFAVTKQLYIIYKNFTALIPGTTVEILDQDSKNVIQLIIAA
YNNIRSKVELSVWDHPEDLSLSFTATCQDGMPLPGLKKCADLKIGDTVSFNVSVEARSCP
PRGANHSFTIKPVGFKDRLEVSVDYRCDCGCSEVAQVNSSVCNSTGTYNCGICHCEPGYL
GAHCECQESEASTIYLNACRGAEGKQVCSGRGKCSCNQCLCYESEFGKIYGSFCECDDFS
CARHKGILCSGHGECHCGECKCHAGYVGDNCNCSTETSSCISDDGQMCSGRGSCVCGRCQ
CTEPGSFGDTCEKCPTCPDACDTKRKCIECRLFNSGGFTDNQTCQRLCKDEIITVETLNT
DDRNAVLCLYKTDDNCVMKFTYSEHTSGQSILTALKEPECGTGTNVLMVLLAVVGSILLV
GVVLLAAWKLVITVHDLREFSRFQSARSRARYEMVRMDNPGVI
NT seq 2472 nt NT seq  +upstreamnt  +downstreamnt
ggtctcaacatatgcaccggcggtagtgctacgagctgccaggagtgcctcctcattcac
cccagctgcgcctggtgtgcgcaagacgtacgtctaccaaatcttgccctagttatcaag
tctcagccgatcgtttttggcgtctcagaagtcccagcgaatgctaacatcagaatttat
ttgtcctttcaggacttcggccaaaggaagaccctgacatcgcggtgtgatttcgaacag
aacttggtcaaaaggggctgcgaccagcgcttcgtcgagagccccagcagtagcatctcc
gtcctgcagaacgttcccctcagttccaaaggtgtgtcccagtatgacgtcgtccagatc
atgccccagaagatggccctcagcctgcgacctggtaggtgtccagtcagggaggactgg
tgtttgttccctgaaaaaccagagatcaaagcggccaagatggtttccaaacgtctcctt
cgggtgtttgctccctcaggaggccagacgtggttccagctgcaggtgcggcaggtggag
gactacccggtggatctgtactacctgatggacctctccctctccatgaaggatgatctg
gacaccatccgtaacctgggcaccaagttggcctatgagatgggcaagctcaccagcaac
ttcaggctgggcttcggctcctttgtggacaagaacatgtcccctttctcctacacagcc
gaaaaatatcgggagaatccctgcaacgggtacaagccgttccccaactgtgtccccacc
ttcggcttccgccacatcctcccgctgaccgacaaggtggacagcttcaacgtggaggtg
cagaagcagatggtgtctcgcaaccgcgacgcgccggagggcggcttcgacgccattctg
caggctgcagtttgcaaggagaagatcggctggaggaaggaggcctaccacctcctggtg
tttgccactgacgacgtgcctcacctcgccctggacgggaggctgggaggcctggtggag
ccccacgacgggcagtgtcacctcgacgacggcagcgagtacagcgcctctaccaagatg
gattatccctctctggcacttctgggagaaaagctggcagaaaataacatctttcttatc
tttgcagtgacaaaacagctgtatatcatttacaagaacttcactgcgctaatacctgga
accacggtggaaatcctggaccaggactccaagaatgtgattcagttgatcatcgcagct
tataataacatcaggtctaaagtggagctctcggtttgggatcatcctgaggacctcagc
ctttccttcactgccacctgccaggatgggatgccactgccaggcttgaagaagtgtgca
gacctgaagataggcgacaccgtttcatttaatgtgagtgtggaagccagaagctgccct
cctcgtggtgccaaccacagcttcaccatcaagccagtgggcttcaaagatcgcctggag
gtgtctgtggattatcgctgtgactgtggctgcagtgaggtggctcaagtgaacagcagc
gtctgcaactccacaggcacctataactgtggcatctgccactgtgagccgggctacctg
ggcgcccactgtgagtgccaggagagcgaggccagcaccatttacctgaacgcctgccgg
ggagcagagggcaagcaggtctgcagcggacgagggaagtgtagctgcaaccagtgtctg
tgctacgagtccgagtttgggaagatctacggcagcttctgcgaatgcgacgatttctcc
tgcgcccgccacaaaggcatcctctgttcaggtcacggcgagtgtcactgtggggaatgt
aaatgtcacgccggttacgtcggtgacaactgtaactgctccaccgagacgtcttcgtgc
atttctgacgatgggcagatgtgcagcgggcggggcagctgcgtgtgtggtcgctgtcag
tgcacggagccgggttcgttcggagatacctgtgagaaatgccccacctgccctgatgcc
tgcgacactaagaggaagtgtatcgagtgccgcctcttcaactctggagggtttacagac
aaccaaacctgccagcgcctgtgcaaggatgaaatcatcaccgtggaaactctcaacacg
gacgaccgcaatgccgtgctttgcctgtacaagactgatgacaactgtgtgatgaagttc
acatattccgagcacaccagcggacagtccatcctcacagcgctcaaagagccagagtgt
ggcactgggacaaatgtcctaatggttctgctcgcggtggtgggcagtatcctcctggtg
ggagtggtactgctggcggcctggaaattggtcatcaccgttcacgacttgagagagttt
tcacgcttccagagtgcacgctcacgtgcccgatatgagatggtaaggatggacaaccca
ggggtgatctaa

DBGET integrated database retrieval system