KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00021995G001
Entry
GSTEN00021995G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K02159  apoptosis regulator BAX
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04115  p53 signaling pathway
tng04141  Protein processing in endoplasmic reticulum
tng04210  Apoptosis
tng04217  Necroptosis
tng05132  Salmonella infection
tng05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:tng00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    GSTEN00021995G001
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    GSTEN00021995G001
   04217 Necroptosis
    GSTEN00021995G001
   04115 p53 signaling pathway
    GSTEN00021995G001
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    GSTEN00021995G001
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    GSTEN00021995G001
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:tng03029]
    GSTEN00021995G001
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tng02000]
    GSTEN00021995G001
Mitochondrial biogenesis [BR:tng03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    GSTEN00021995G001
Transporters [BR:tng02000]
 Other transporters
  Pores ion channels [TC:1]
   GSTEN00021995G001
SSDB
Motif
Pfam: Bcl-2 DUF997
Other DBs
NCBI-ProteinID: CAG02784
UniProt: Q4S998
LinkDB
Position
3
AA seq 192 aa
MASHPGGGDQGNSNDQVLEVGCLLLKDFIFERVQRYGESNTVVTRAQLGGGELCDPNHKK
LANYLQKIGDELDSNMELQRMIDDSALKPTKDMFMKVAFEIFSDGKFNWGRVVALFYFAC
RLVIKALVTHVPDIIRTIISWTMDYLQEHVANWIREQGGWEGIRSYFGTPTWQTVGVFLA
GVLTTVLVIRKM
NT seq 576 nt   +upstreamnt  +downstreamnt
atggcatcgcacccaggaggaggcgatcaaggaaattcaaacgatcaggtactggaagtt
ggctgtcttttgttaaaagattttatttttgagcgcgttcaacgatatggagaaagcaat
actgttgtgacgagggctcaactaggtggaggagaactatgtgacccaaaccacaagaaa
cttgccaactacctacagaagatcggcgatgagctggacagcaatatggagctccaaaga
atgatagatgattctgcactcaaacccacaaaggacatgtttatgaaggttgcctttgag
atcttttcggatggaaagttcaactggggcagggttgttgcactattctactttgcctgt
cgccttgtcatcaaagcacttgtgacccacgttcctgatattattagaaccataattagc
tggaccatggactacctccaggaacatgtggccaactggatcagagagcagggtggatgg
gagggtattcgctcctactttggcacgccaacatggcagacggtaggagttttcttggct
ggtgtcctcactactgttctagtgattcgcaagatg

DBGET integrated database retrieval system