KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00022069G001
Entry
GSTEN00022069G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K10128  reprimo, TP53-dependent G2 arrest mediator candidate
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:tng00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    GSTEN00022069G001
SSDB
Motif
Pfam: Tmemb_9 ACP_syn_III
Other DBs
NCBI-ProteinID: CAG02841
UniProt: Q4S941
LinkDB
Position
3
AA seq 109 aa
MNVSFFDVTKDALLNGSQTLAGTLAAYPGNGTDNVVTGDGGGSLVLAQDERKLFVMRVVQ
IAVLCVLSLTVVFGIFFLGCNLMIKSESMINFLVRERRPSKDVETVMIG
NT seq 327 nt   +upstreamnt  +downstreamnt
atgaacgtctccttctttgacgtgacaaaggacgctctgctaaacgggagccagaccctt
gccggcactctggcagcataccccggcaacggcaccgacaacgtggtgactggcgacggc
ggcgggtctctggtgctggcgcaagacgagcgcaaactcttcgtcatgcgtgtggtgcaa
atcgccgtgctgtgcgtgctgtcactcactgtcgtgttcgggatattttttcttgggtgc
aacttaatgatcaagtcggagagcatgattaacttcctcgtgagggaacggagaccttcg
aaagacgtggagacggtgatgatcgga

KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00030547G001
Entry
GSTEN00030547G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K10128  reprimo, TP53-dependent G2 arrest mediator candidate
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:tng00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    GSTEN00030547G001
SSDB
Motif
Pfam: Tmemb_9
Other DBs
NCBI-ProteinID: CAG09313
UniProt: Q4RQL9
LinkDB
Position
2
AA seq 102 aa
MNSTGSNQTEGELLNRTAEFFCCNFSSVVTDDGFVAAAPDERSLFIMRVVQIAVMCVLSL
TVVFGIFFLGCNLLIKSEGMINFLVTDRRPSKETEAVIVGAY
NT seq 306 nt   +upstreamnt  +downstreamnt
atgaacagcacgggctcgaaccagacggagggcgagctgctcaacaggacggcggagttc
ttctgctgcaacttctcctcggtggtgaccgacgacggcttcgtggcggcggccccggac
gagaggagcctcttcatcatgagggtggtccagatagccgtcatgtgcgtcctgtccctc
accgtggtctttggcatcttcttcctgggctgcaaccttctgatcaagtccgaggggatg
attaacttcctggtgacggacaggaggccgtccaaagagacggaggctgtgattgttgga
gcctac

DBGET integrated database retrieval system