KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00022527G001
Entry
GSTEN00022527G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K10148  tumor protein p73
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:tng00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    GSTEN00022527G001
Transcription factors [BR:tng03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    GSTEN00022527G001
SSDB
Motif
Pfam: P53 P53_tetramer SAM_2 SAM_1
Other DBs
NCBI-ProteinID: CAG03195
UniProt: Q4S837
LinkDB
Position
9
AA seq 662 aa
QSTVTEEGGTFEHLWSSLEPDSTYYELPPGSQQGERPLASTSTPGCHCSAAESSMDVYHL
RDMNDNVMSQYNLLSSSMESLGSRATSASPYSSENASSSAVPTPSPYSQPNSTFEGLSPA
PTIPSNTDYPGLHAFQVSFQQSSTAKSATWTLDAKPSPSLLSLPQYSPLLKKLYCQIAKT
CPIQIKLSSSPPHGSIIRAMPIYKKAEHVTEVVKRCPNHELGRDFNDGQTAPASHLIRVE
GNNLCQYVGTEFTTILYNFMCNSSCVGGMNRRPILIIITLETRDGQVLGRRSFEARICAC
PGRDRKADEDHFREQQALSDSVDKNGSANKRNFKQSLPNIQNPNLNTRKRRHGEEDVYYI
PVRGRENFELLMKIKDSLELVELVPQPLLDSYRQQTQQFLQRPGHISSPTSYSPLSNMNK
LHNQGGISKPSSVNLMGQQPQQHHSAPSSLAHMGSNMLSSHHMQANGDMNGSHSNQTIVS
ASHCSPPPPYNPDPSLVSFLTSLGCQNFIEYFASQGLQSVYHLQTLSMEDLGAMKIPEQS
RLAIWRALQDLKQDGPLQLPATTHHHDYHGQQLIRSSSNMTASAMAAIGGPGGELQRQRV
MEAVHFRVRHTITIPHRSGAVGTSGMAAAADEWADFGFDMPDCKLSCSKHSIKEEFMESD
VH
NT seq 1989 nt   +upstreamnt  +downstreamnt
cagtccaccgtcactgaagaaggaggcaccttcgagcatctctggagctccctggagcca
gacagcacctactatgagcttcccccaggcagccagcagggagagcgtccactggcctcc
accagcaccccagggtgtcactgcagtgctgctgagagctccatggacgtctaccacctg
agagacatgaatgacaacgtgatgtcccaatacaacttgctcagcagcagcatggagagc
ctggggagccgcgcgacgtccgccagcccctacagctccgagaacgcctcctcgtcggcc
gtgcccaccccttcgccctactcccagcccaactccacgtttgagggcctttcccctgcc
ccgaccatcccctccaacaccgactaccctggactgcacgccttccaggtgtccttccag
cagtccagcaccgccaagtctgcaacatggaccctagatgctaagccgtctccatctctg
ctctccctccctcagtactctccgttgctgaagaaactctactgtcagattgccaagacc
tgtcccatccagatcaagctatcctcgtctcctccgcacggcagcatcatcagggccatg
cccatttataagaaggccgagcacgtcacggaagtggtcaaacgctgccccaaccacgag
ctagggcgagacttcaatgacggtcaaacagctccggccagccacctgatccgagtggag
gggaataacctctgtcagtacgtggggactgagttcaccaccatcctgtacaacttcatg
tgcaacagcagctgtgtgggtggcatgaacagaagacccatcctcatcatcatcaccctc
gaaaccagggacggtcaggtgttggggaggaggtcgtttgaagctcggatatgtgcgtgt
cctggacgagatcgcaaagcagacgaggaccacttcagggaacagcaggccctgagcgac
agcgtggacaaaaacggaagcgccaacaagcgcaatttcaaacagagtctgccgaacatt
caaaacccaaacctaaacacgaggaagaggaggcacggggaagaagacgtttattatatt
cctgttcgtggacgtgagaattttgaactgctgatgaagattaaagacagtttggagctg
gtggagctggtgccgcagccgctgttggactcatacagacagcaaacacagcagttcctg
cagagaccgggccacatctcatcccccacttcttactcgccactgtccaacatgaacaag
ctccacaaccagggcggcatcagcaaaccctcctccgtcaacctgatggggcagcagccc
cagcaacaccactctgccccctcctccctcgctcatatgggttccaacatgctcagcagc
caccacatgcaggccaacggcgacatgaatggtagccacagcaatcagactatagtgtct
gcctcccactgtagcccgccccctccgtataaccctgaccccagcctcgtcagtttttta
accagtctgggctgtcagaacttcattgagtacttcgcctcccaaggcctgcagtccgtg
taccatctccagacactctccatggaggacttaggagccatgaagatacccgagcagtcc
cgcctcgccatctggcgagctctgcaggacctgaaacaagacgggcccctgcagctgccc
gccaccacgcatcaccacgattaccacggccagcagctcattcgctccagcagcaacatg
acagcctccgccatggcggccatcgggggaccgggcggggagctgcaacgtcagcgcgtc
atggaggccgtgcactttcgcgtccgtcacaccatcaccattccccacaggtcaggtgct
gtgggaacttctgggatggcggcggccgctgacgagtgggccgactttggcttcgacatg
cctgactgcaagctgtcgtgcagcaagcactccatcaaggaggagttcatggaaagcgac
gtgcactga

DBGET integrated database retrieval system