KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00022976G001
Entry
GSTEN00022976G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K16857  thrombospondin 1
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04115  p53 signaling pathway
tng04145  Phagosome
tng04350  TGF-beta signaling pathway
tng04510  Focal adhesion
tng04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:tng00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    GSTEN00022976G001
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    GSTEN00022976G001
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    GSTEN00022976G001
  09143 Cell growth and death
   04115 p53 signaling pathway
    GSTEN00022976G001
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    GSTEN00022976G001
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tng04131]
    GSTEN00022976G001
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:tng00536]
    GSTEN00022976G001
   04990 Domain-containing proteins not elsewhere classified [BR:tng04990]
    GSTEN00022976G001
Membrane trafficking [BR:tng04131]
 Endocytosis
  Phagocytosis
   Opsonins
    GSTEN00022976G001
Glycosaminoglycan binding proteins [BR:tng00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   GSTEN00022976G001
Domain-containing proteins not elsewhere classified [BR:tng04990]
 Thrombospondin domain-containing proteins
  Thrombospondins
   GSTEN00022976G001
SSDB
Motif
Pfam: TSP_C TSP_3 TSP_1 TSP1_spondin VWC EGF_CA EGF_3 TSP1_ADAMTS EGF cEGF TSP1_CCN
Other DBs
NCBI-ProteinID: CAG03524
UniProt: Q4S758
LinkDB
Position
14
AA seq 1193 aa
GIFLLLILWTCESTRVAESRDDNSVYDLFELVQVPRKNHGVTLVKGDDPYSPAYKILDPD
LIPAVPDQAFSDLIDSIRAERGFLLLLNFKQFKRTRGSLLTVEKKDGSGPVFEIISNGKA
NTLDIVFSTENKQQVVSIEEEDQAQLYVGCEDVNTAELDAPIQSILTQETPAGARLRIGK
GAVNDRFMGVLQNVRFVFGTTLDAILRNKGCQNSISSETMILENLNGSSAIRTEYTGHKT
KDLQMVCGFSCEDLFSMFKELKSLGVVVKELSNELRQLTDENKLIKNHIGIHNGVCIHNG
IMHKNKEEWKVDDCTECTCQNSATVCRKISCPVISCANATIPDRECCPHCGTPRDSAEDS
WSPWSEWTHCSVSCGRGIQQRGRSCDRINNNCEGTSVQTRDCYIQECDKRFKQDGSWSHW
SPWSSCSVTCGAGVITRIRLCNSPTPQFGGKSCTGEGRQTEKCQKSSCPINGNWGPWSPW
DTCTLTCGGGVQIRKRLCNDPEPKYGGKDCVGDAKDIQICNNKSCPIDGCLSNPCFAGVK
CTSFPDGSWKCGKCPVGYSGNGIKCKDIDECKEVPDACFEFNGVHRCENTDPGYNCLPCP
PRYSGPQPYGKGVEQAVAKKQICTPRNPCLDGSHECNKNARCNYLGHFADPMYRCECKPG
YAGNGHICGEDTDLDGWPNLDLICVENATYHCKKDNCPNLPNSGQEDYDNDGIGDACDND
DDNDGIPDDRDNCPFVYNPRQYDYDRDDVGDRCDNCPYNSNPDQTDTDNNGEGDACAVDI
DGDGILNEKDNCPYVYNVDQRDTDLDGVGDMCDNCPLEHNPDQVDTDDDRVGDKCDSNQD
IDEDGHQNNLDNCPYIPNANQADHDKDGKGDACDHDDDNDGIPDDKDNCRLAFNPDQLDS
DGDGRGDACKDDFDQDNVPDIYDVCPENFDISETDFRKFQMVPLDPKGTSQIDPNWVVRH
QGKELVQTVNCDPGIAVGYHEFNSVDFSGTFFINTERDDDYAGFVFGYQSSSRFYVVMWK
QITQTYWSNKPTKAQGYSGLSIKVVNSTTGPGEHLRNALWHTGNTAGQVRTLWHDPKNVG
WKDFTAYRWHLIHRPRTGLIRVVMYEGKKIMADSGSIYDKTYAGGRLGLFVFSQEMVYFS
DLKYECREKYLRHYVRRDTRMRPFSERPGRLYCTPLEKYSALREMGSLDNGPV
NT seq 3582 nt   +upstreamnt  +downstreamnt
ggaatatttttgcttttgatactttggacctgtgagagtacgcgagtggcagagagccga
gacgacaacagcgtttatgacttgttcgagctcgtccaggtccccaggaagaaccacggg
gtcacgctggtcaagggcgatgatccctacagccctgcctacaagatcctcgacccggac
ctgatccccgccgtccccgaccaagccttcagtgacctgatcgactccatccgcgccgaa
agaggattcctcctgctgctcaacttcaagcagttcaaacgaaccaggggaagccttctc
accgtggagaagaaggacggctccggacccgtgtttgagatcatctccaacgggaaagcg
aacacgctggacatcgttttctccacggagaacaagcagcaggtggtttccatcgaagag
gaggaccaggcgcagctctacgtgggatgcgaggacgtgaacacagccgagctggacgcg
cccatccagagcatcctgacgcaggagaccccggccggtgcgcgcctccggatcggcaag
ggcgcagtgaacgaccggttcatgggcgttctacaaaacgtgcgctttgtgtttggaacc
acactagatgccatcctccggaacaaaggatgccaaaactctatttcaagtgaaactatg
atcctggagaacctgaatggctcctcagccatcagaacagagtacactggacacaagact
aaagacctgcagatggtctgcggcttttcctgcgaggacctgttcagcatgttcaaggaa
ctgaagagtctcggcgtggtcgtaaaagaactgtccaatgagctccgtcagctgacagat
gagaacaagctgataaagaaccacatcggcatccacaacggcgtctgcatccataatggc
atcatgcacaagaacaaagaagagtggaaggtagacgactgcactgagtgcacttgtcag
aactctgctactgtgtgtcgcaagatctcctgtcctgtgatctcctgcgctaatgctact
atacctgatcgggaatgctgccctcactgtggaacaccgagggactctgcagaggacagt
tggtcaccgtggtctgaatggacccattgttctgtatcatgtgggcggggcatccagcag
cgtggtcgctcttgcgatcgtatcaataacaactgtgagggcacctcagtgcagacccga
gactgctacatacaggagtgtgacaagcgattcaagcaagacggcagctggagtcactgg
tcgccttggtcatcttgctctgtcacctgtggcgctggtgtcattacccgtatccgtctg
tgtaactcccccaccccccagtttgggggcaaaagctgtacaggagagggtcgacaaact
gagaagtgtcaaaagtcttcgtgcccgatcaatggtaactgggggccttggtcaccgtgg
gacacatgcactctcacttgtggtggtggcgttcaaattcgtaagcgtctctgcaatgac
cccgaaccaaaatatggtggaaaagattgtgttggagatgccaaagacatccagatatgc
aacaacaaatcctgcccaattgatggatgcctgtctaacccctgctttgctggagtcaag
tgcaccagttttcctgatggttcctggaagtgtggaaagtgcccagttggctacagtggt
aatggaatcaagtgtaaagacattgatgagtgcaaggaggttcctgacgcgtgctttgag
tttaatggcgtgcaccgctgcgagaacacagatcctggctacaactgtctaccttgtcct
cctcgctactcaggaccccaaccgtatggtaaaggtgttgagcaggctgttgctaaaaaa
cagatctgcactcctcgtaatccctgccttgatggaagccatgagtgcaataaaaatgcc
cgctgtaactaccttggacactttgccgatcccatgtatcgctgtgagtgcaagcccggc
tatgctggcaatggccatatctgtggagaggacacggatctggatggttggcccaattta
gacctgatttgtgtggaaaacgccacctaccactgcaagaaggataactgtcccaacctt
cccaattcggggcaagaagattacgataacgatggtattggagatgcttgtgacaacgat
gatgacaatgatggcattcccgatgacagggacaactgtccatttgtgtacaaccccagg
cagtatgattatgaccgagacgatgtgggtgaccgctgtgacaactgcccgtacaatagt
aacccagaccagacagatacagacaataatggagagggagacgcttgtgctgtggacatt
gatggagatggcatactgaatgagaaggacaattgtccctatgtgtacaatgttgatcaa
agagacacagacctcgatggtgtgggagacatgtgtgacaactgtcccctggaacataat
cctgatcaggtggacacagatgacgatcgtgtaggagacaagtgtgacagcaaccaggac
atcgatgaagacggacaccagaacaatctggacaactgcccatacataccgaatgccaac
caggcagaccatgacaaggatggaaagggagacgcttgtgatcatgatgatgataatgat
ggcatccctgacgacaaggacaactgcaggcttgccttcaaccctgaccagctggactct
gatggcgatggtcgtggtgatgcgtgcaaggacgactttgaccaagacaatgtgcccgac
atctacgatgtgtgcccagagaactttgacattagtgagacggatttccgtaaattccag
atggttcctctggaccccaaaggcacatcgcagattgaccctaactgggttgtccgccat
caaggcaaagagctggtccagacagtcaactgtgatcctggtattgctgttggctaccat
gaattcaattcagtggacttcagcgggacgttcttcatcaacacagagagggatgatgac
tatgctggctttgtgtttggctaccagtccagctccaggttttacgttgtgatgtggaag
caaattacacagacttactggtcaaataaacccaccaaggcccagggttactctggccta
tccatcaaagtggtcaactcgaccaccggcccaggagagcacctccggaatgctctctgg
cacacaggaaacactgcgggacaagtccgtactctctggcacgaccctaagaatgttgga
tggaaggattttactgcctacaggtggcatctgatccatagaccaagaactggactcatc
agagttgtgatgtatgagggcaagaaaattatggctgattccggaagcatatatgacaag
acctatgcgggaggcagactaggtctttttgtcttctcacaagagatggtatacttctca
gacctcaagtatgaatgcagagagaaatatctgcgtcactatgtcaggagggacacaaga
atgaggcctttctccgagcggcccggccggctctactgtacacctttggagaagtactca
gcactgagggagatgggttcgcttgataatggacccgtctaa

KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00032374G001
Entry
GSTEN00032374G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K16857  thrombospondin 1
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04115  p53 signaling pathway
tng04145  Phagosome
tng04350  TGF-beta signaling pathway
tng04510  Focal adhesion
tng04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:tng00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    GSTEN00032374G001
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    GSTEN00032374G001
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    GSTEN00032374G001
  09143 Cell growth and death
   04115 p53 signaling pathway
    GSTEN00032374G001
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    GSTEN00032374G001
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tng04131]
    GSTEN00032374G001
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:tng00536]
    GSTEN00032374G001
   04990 Domain-containing proteins not elsewhere classified [BR:tng04990]
    GSTEN00032374G001
Membrane trafficking [BR:tng04131]
 Endocytosis
  Phagocytosis
   Opsonins
    GSTEN00032374G001
Glycosaminoglycan binding proteins [BR:tng00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   GSTEN00032374G001
Domain-containing proteins not elsewhere classified [BR:tng04990]
 Thrombospondin domain-containing proteins
  Thrombospondins
   GSTEN00032374G001
SSDB
Motif
Pfam: TSP_C TSP_3 TSP_1 TSP1_spondin VWC EGF_3 TSP1_ADAMTS Laminin_G_3 EGF_CA cEGF Laminin_G_2 Laminin_G_1 TSP1_CCN EGF zf-NADH-PPase
Other DBs
NCBI-ProteinID: CAG10667
UniProt: Q4RLR5
LinkDB
Position
10
AA seq 1171 aa
MMLCGIFLLLMLWGCEGARLAGSPDDNSVYDLFDLARVSKRQNGVTLVKGADPYSPAYKV
LNADLIPSVPDSSFRDILDSILAERGFLLIINLKQFRKSRGSILTIEKNDGSGSIFEIVS
NGRANTLEVLYSTANHQQVVTIEDTDLATGHWKNITLFVQDDRVKLYVGCEEVNEAEMDF
PIHKVLTQELADVATLRIAKGAVRDKFTGVLQNVRFVFGTSLDEILRNKGCQNGAVLTDV
MTLENPVNGSSPAVQTDHPGHKAKDVQPGQVCGLSCEDIAGIFKELRGLGVVVRKLSIDL
RKVSEESMLLKNETKQSGICIHNGIVYQDKNEWTVDSCTECTCQNSATVCRKISCPLVPC
ANATVPDGECCPRCGSSMVSAQGGWSPWSAWTQCSVTCGRGVQQRGRSCDRINSNCEGTS
VQTRDCYPQECDKRFKQDGAWSHWSPWSSCSVTCGEGVITRIRLCNSPTPQMGGMDCQGE
GRQTEICRKSPCPIDGGWGPWSPWDTCTLTCGKGIQTRKRLCSDPAPRFGGKDCVGEAKM
SQVCNKQDCPIDGCLSNPCFPGAMCTSFPDGSFRCGKCPLGYTGDGLTCKDIDECKEVPD
ACYVHNGVHLCENTEPGYNCLPCPARFSGPQPFGRGVEQATAKKQVCEPRNPCRDGSHDC
HKNANCIYLGVYSESMFRCECKPGYAGNGHICGEDSDLDGWPNHNLVCVENATYHCSKDN
CPSLPNSGQEDHDKDGLGDECDTDDDNDRIPDDRDNCPRLYNPAQYDADRDDVGDLCDNC
VFEANTDQTDTDSNGEGDACAVDIDGDGILNEDDNCPYVYNVDQRDTDRDGVGDHCDNCP
LEHNPDQIDSDSDRVGDKCDNNQDIDEDGHQNNLDNCPYIPNANQADHDKDGKGDACDHD
DDNDGIPDDKDNCRLAFNPDQTDSDGDGRGDICKDDFDQDSVLDIYDVCPENFAISETDF
RRFQMVPLDPTGTSQIDPNWVVRHQGKELVQTVNCDPGIAVGYDEFSAVDFSGTFFINTD
RDDDYAGFVFGYQSSSRFYTVMWKQITQTYWSTTPTRAQGYSGLSIKVVNSTTGPGEHLR
NALWHTGDTAGQVRTLWHDPKKIGWKDFTAYRWHLTHRPKTGLIRVVMYEGKRIMADSGN
IYDKTYAGGRLGLYVFSQEMVYFSDLKYECR
NT seq 3513 nt   +upstreamnt  +downstreamnt
atgatgctgtgtggcatctttttgctgctgatgctttggggctgcgaaggtgccaggctg
gctggcagcccagatgataacagtgtctatgacctttttgatctggcccgggtgagcaag
cgtcagaatggagtaactctggtcaaaggtgccgatccctacagccctgcctacaaggtt
ctgaatgcagacctgatcccctcagtccccgacagctccttcagggacatccttgactcc
atcctggctgagaggggcttcctgctcatcatcaacctgaagcagttcaggaaaagccga
ggcagcattttgaccattgagaagaatgacggctctggatccatttttgagattgtttcc
aacgggagggcaaacaccctggaagtgctctactccaccgccaaccaccagcaggtggtg
actatcgaggacacagatttggccacgggacactggaaaaacatcacgctgttcgttcaa
gacgatcgagtgaagctttacgtgggttgtgaggaagtcaacgaggcagagatggacttt
cccatccacaaagtgctcacccaggagctggcggacgtcgctaccctcaggatcgccaag
ggagcagtgagggacaaattcacgggagtgcttcagaacgtgcgctttgtttttgggacc
tcacttgatgagatattaagaaacaaaggatgccagaacggagctgtgttaaccgatgtc
atgaccctggagaaccccgtcaacggctccagccccgccgtccagaccgatcatcctggc
cacaaagccaaagatgtccagcctggacaggtctgtggtttgtcctgtgaagacatcgca
ggcatatttaaggagctcaggggacttggtgtggttgtgagaaaactgtccattgaccta
cgcaaagtgtctgaggaaagcatgctgctgaaaaatgagacgaaacaaagtggaatctgc
atccacaacggcattgtgtaccaggacaagaatgaatggacggtggacagctgcaccgag
tgcacctgccagaactctgctacggtgtgtcgcaaaatctcctgccccctggtcccatgc
gctaacgctaccgtgcctgatggagagtgctgcccacgctgcgggagttccatggtctca
gcacagggtggctggtccccctggtctgcgtggacccagtgttccgtgacctgtggtcgg
ggcgtccagcagcgtggacgctcctgcgaccgcatcaacagcaattgcgagggcacctcg
gtccagacccgtgactgctacccccaggaatgcgacaaacgattcaaacaggacggcgcc
tggagccactggtccccctggtcatcatgctctgtgacctgtggtgagggggttatcacc
cggatacgcctctgcaactcccccacaccccagatgggtggcatggactgccagggtgaa
ggacgtcaaactgaaatctgccgcaagtcaccttgtcccatcgatggagggtggggaccg
tggtcaccatgggacacctgcactctcacttgcggcaaaggaattcagacccgcaagcgt
ctgtgctcggaccctgcccccagatttggaggaaaggattgtgttggtgaggctaagatg
tctcaggtgtgcaacaaacaagactgtcctattgatggctgtctgtccaacccttgcttc
cctggtgcaatgtgcaccagtttcccagacggctccttccgttgtggcaagtgtccactt
ggctacaccggagacggcctcacttgcaaggacatcgatgagtgcaaagaggttcccgat
gcctgctacgttcataatggagtccatctgtgtgagaacacagaaccaggttacaactgt
ctgccctgccctgcacgcttctctggccctcagccctttgggaggggagtagagcaggca
actgccaaaaaacaggtttgtgagccccgcaatccctgtcgggatggcagccacgactgc
cacaaaaatgcaaactgcatttacctcggcgtctacagcgagtccatgttccgctgtgag
tgcaaacctgggtacgctggaaatggtcacatctgtggagaggacagcgacctggacgga
tggcccaaccacaacttggtgtgtgtggagaacgccacctaccactgcagcaaggacaac
tgccccagtcttcctaattccggccaggaggatcatgacaaagatggcctgggtgatgaa
tgcgacacggatgatgacaatgacaggattccagatgatagggacaactgtccaagactg
tacaaccctgcgcagtatgacgcagacagagatgatgttggtgatctctgtgacaactgt
gttttcgaggctaacactgaccaaactgacaccgacagtaatggagagggtgacgcctgt
gctgttgacattgacggtgatggtatcctgaacgaggacgacaactgcccgtatgtttat
aacgtggatcagagagacactgacagggacggcgtgggtgaccactgtgacaactgccct
ctggaacacaaccctgatcagattgattcagactcagatcgtgtgggagacaagtgtgac
aacaaccaagacattgatgaggacggtcaccagaacaacttggacaactgcccctatata
cccaacgccaaccaggctgaccatgacaaggatggaaagggtgatgcctgtgaccatgac
gacgacaacgatggcattcctgatgacaaagacaactgtcggctggcttttaaccctgat
cagacagattctgatggcgatggccgtggtgatatctgcaaagatgactttgatcaagac
agtgttttggacatttatgacgtgtgccctgagaattttgccatcagtgaaacagatttc
cgcagattccaaatggtgcctttagacccaacaggcacctcacagatcgaccccaactgg
gtggtgcgacatcagggcaaggagttggtccagactgtcaactgtgatcctggcatcgct
gttggttatgatgagttcagcgcagtggatttcagcgggaccttctttatcaacacggac
agagacgatgactacgctggctttgtgttcggttaccagtcaagctcacgcttctacacg
gtgatgtggaaacagatcacacagacgtactggtctaccacacccacgagagctcaaggt
tactctggcctgtcaatcaaagttgtcaattccaccactggtcccggtgagcacttgagg
aatgccctgtggcacacgggagacaccgcaggacaggtgcgtactctgtggcatgacccc
aagaaaattggctggaaggacttcacagcctacagatggcatctgacccacagacccaaa
actggacttattagagtggtcatgtacgaaggcaaaagaataatggctgattctggaaac
atctacgacaagacatacgctggtgggcgactaggcctgtacgtgttctctcaggagatg
gtttacttctctgatctgaagtatgaatgcaga

DBGET integrated database retrieval system