KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00023089G001
Entry
GSTEN00023089G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K10141  sestrin 1/3
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:tng00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    GSTEN00023089G001
SSDB
Motif
Pfam: PA26 CMD CoA_transf_3
Other DBs
NCBI-ProteinID: CAG03611
UniProt: Q4S6X1
LinkDB
Position
14
AA seq 603 aa
MIPYVHKAAGRLFLHVLVLDLLVRGMHTSSLRKAEAWRHRCTLNSCQNTQRSERRRLGKE
ERGLRADVQPRLEMRLAVAPPENVENSSLSMTSLFKICSHCERLSKKDLGVRIPRPLGNG
PSRFIPEKEILKVSKVADRTQAIFEDAFSMLGRLDNVSVVMGFHPHYLESFLRTQHYLLQ
MDGPLSLHYRHYIGIMAAARHQCSYLVNLHVNDFLQVGGDPKWLNGLDQAPPKLQQLGEL
NKVLAHRPWLLTKEHIEEMCGEVEVLMERMKQLQECRDDEEASQEEMATRFEREKTESML
VVTAEDEDSAPSRDVSRHFEDPSYGYTEFSRRGEQVPTFRAQVRMRHSRSWVSGAPPRSL
TLLFLNRAGLQLGGPRVLPGQPAVPRRGTDAGREVPAGLQPHLQHHGHAQGRGHQHAAPG
HLELHPLHVRHQVGSRSALRPQAHGRRRVCLTSPLLASIRYDDYDYGEINQLLDRSFKIY
IKTMVCSPEKTTKRMYESFWRQFQHSEKVRPSLLLRPMASAPAPSLTRLFSSAGPREFAS
YGSPNAGRTVVRSESDHPLHDMKCISRFSVVVFRTVTVAHYQTLYGEKQTGREGEVNKTM
AGM
NT seq 1812 nt   +upstreamnt  +downstreamnt
atgattccgtatgttcacaaagctgcaggacgccttttcctccatgtgctggtcctggac
ctgctggtcagggggatgcacacctcttccctcaggaaagccgaggcctggcgacaccgc
tgtactctgaattcctgccagaatacacagagatcagagaggaggcgattaggaaaagaa
gaaaggggactacgagccgacgtgcagccaagactcgagatgaggctcgcggtggctccg
ccagaaaacgtagaaaacagttctttatcgatgacaagcctgttcaagatatgctcccac
tgtgaacggctgagcaaaaaggatttaggagtccgaatccccagacccctgggtaacggc
ccaagcagatttatccctgaaaaagagattttaaaagtcagtaaagtggctgacaggaca
caggcgatattcgaggatgccttttcgatgctgggccgtctggacaacgtttcggtggtg
atgggtttccacccccactacctggagagctttctgcggactcagcactacctgctgcag
atggacgggcccctgtctttgcactaccgacactacatcggcattatggcggcagcccga
caccagtgttcctacctggtcaacctgcacgtcaacgacttcctccaggtgggcggcgac
cccaagtggctgaacggtttggaccaagccccgccaaagctgcagcagctgggggagctc
aacaaggtcctggcccacagaccgtggctcctcaccaaggaacacatcgaggagatgtgt
ggggaggtggaggtgctgatggagcgcatgaagcagctgcaggagtgccgagacgacgag
gaggccagtcaggaggagatggccactcgcttcgagagggagaaaacggagagcatgctg
gtggtcacagccgaggacgaggacagcgccccctccagggacgtctccaggcactttgag
gaccccagctacggctacacggagttctccaggaggggggagcaggtgcccaccttcaga
gcgcaggtgcggatgcgccacagccgcagctgggtcagcggtgcccccccgcggtcgttg
acgttgttgtttttgaatcgggcaggactacagctgggaggaccacgggttctccctggt
caaccggctgtaccccgacgtgggacagatgctggacgagaagttccagctggcctacaa
cctcacctacaacaccatggccacgcacaaggacgtggacaccagcatgctgcgccgggc
catctggaactacatccactgcatgttcggcatcaggtgggttcccgctcggctctccgg
ccgcaggctcacgggcgccgccgcgtttgcctcacctcgccgttgctcgcctccatcaga
tacgacgactacgattacggggagatcaaccagctcctggaccgtagcttcaagatctac
atcaagactatggtgtgcagtccagagaagaccaccaaacgaatgtacgagagtttctgg
aggcagtttcagcactccgagaaggtgaggccttcactgctcctccgccccatggcctca
gctcctgctccgagtttgaccaggctcttttcctccgcaggtccacgtgaatttgcttct
tatggaagcccgaatgcaggcagaactgttgtacgctctgagagcgatcacccgctacat
gacatgaagtgcattagccgttttagcgttgtcgtctttcgtactgtaactgttgctcat
tatcagacactttatggagaaaaacaaacggggagggaaggggaggtcaacaaaactatg
gctgggatgtga

KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00031208G001
Entry
GSTEN00031208G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K10141  sestrin 1/3
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:tng00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    GSTEN00031208G001
SSDB
Motif
Pfam: PA26
Other DBs
NCBI-ProteinID: CAG09784
UniProt: Q4RP98
LinkDB
Position
1
AA seq 459 aa
VMVNAEKERVSLLFTKALVSSGAVDAVSQQMSSHPQYLESFLRTQHYILHMDGPLPLPYR
HYIAIMVRPARPPPPPSSSSSSSSSSSSTLSSLLSGCGAISLSLPGPPSLGSFPEGGRGP
AVVRGLEATPPRLRLLDHINKVLAHQPWLAACSHIQTLLGEQCWSLAELVQAVVILAHCH
ALCSFVFGCDTSPDNVPPSTSPNGTPPTFCPFDAANGNANVPQTPAAPSEHKAHPRVGLR
PPPAARQPRQLTHGRGSHTHTHSHTHTHTHTLSVCLFFSEMEEEEETLCLADPTRFTTDP
DFCYQEFGRREDDHFQVFRVQDYSWEDHGFSLVNRLYSDIGHLLDERFRSVTSLPSLRST
DLKRAIWNYIHCVIGIRYDDYDYGEVNQLLPRDLKLYIKGVACFPDATKTPASTPPPPRR
PWPDSPFALPQTQVNLLIMEARLQGELLYALRAITKYMI
NT seq 1377 nt   +upstreamnt  +downstreamnt
gtgatggtgaacgctgagaaggagcgcgtgtcgctgctcttcaccaaggccctggtgagc
tcgggcgccgtggacgccgtgtcccagcagatgtcctcccacccgcagtacttggagagc
ttcctgcgcacgcagcactacatcctgcacatggacggccccctcccgctgccctaccgc
cattacatcgccatcatggtccgtccggcaaggccgcccccccccccttcctcctcctcc
tcctcctcctcctcctcctcctcaacgctttcttctctgctttcaggctgcggcgcgata
tcactgtcactacctggtccaccttcactcggctcatttcctgagggtgggcggggaccc
gctgtggtgcgcggcctggaggccacgcccccgcgcctgcgtctcctggaccacatcaac
aaggtgctggctcatcagccctggctggccgcctgctcacacatccagacgctgctgggg
gagcagtgctggtcgctggcggagctggtgcaggcggtggtcatcctggcccactgccac
gccctctgcagcttcgtctttgggtgcgacaccagcccggacaacgtccctccgtccacc
tctcccaacgggacgccgcccaccttctgccccttcgacgccgccaacggcaacgccaac
gtgcctcagacgcccgccgctccctcggaacacaaagcacacccgcgggtgggtctcagg
ccaccacctgccgcccgtcagccccgtcagctgacccacggcagggggtctcacacacac
acacactcacacacacacacacacactcacacactttccgtgtgtctttttttttcagaa
atggaggaggaggaggagaccttgtgcttggccgaccccacacgcttcacgaccgacccg
gatttttgctatcaggagtttgggcggcgcgaggacgaccactttcaagtatttagggtt
caggactattcgtgggaggaccacggcttctccctggtcaaccggctctactcggacatc
gggcacctcctggacgagcgcttccgcagcgtgaccagcctgccctccctgcgcagcacc
gacctgaagagagccatctggaattacatccactgcgtgatcggaatacggtacgacgac
tacgactacggggaggtcaaccagctgctgccccgagatctgaagctgtacatcaaaggc
gtggcttgtttcccagacgccaccaagactcccgcgtccacgccccccccaccacgccgc
ccttggcctgattcccctttcgccctcccccagacgcaggtgaatctgctgatcatggag
gcccggctgcagggcgagctgctgtacgccctgagggccatcaccaagtacatgatc

DBGET integrated database retrieval system