KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00023330G001Help
Entry
GSTEN00023330G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K11424  histone-lysine N-methyltransferase NSD2 [EC:2.1.1.43]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:tng00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    GSTEN00023330G001
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:tng03036]
    GSTEN00023330G001
Enzymes [BR:tng01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     GSTEN00023330G001
Chromosome and associated proteins [BR:tng03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     GSTEN00023330G001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PWWP SET PHD zf-HC5HC2H zf-HC5HC2H_2
Motif
Other DBs
NCBI-ProteinID: CAG03790
UniProt: Q4S6E2
LinkDB All DBs
Position
10
AA seq 1443 aa AA seqDB search
MDSKGSSLPSMPEPANPISMKQLPEPLSVRKNGGDMSSDHSMLIDKAAAHLAATLQDSVL
QKMASHSHSNHSHERLKDLTSLVLNGDQDALPKLCTPEQSLLKSAEVPTANGTHPRNRSP
HSEPELKVTIPQVVKQQPQLEPSSANGTSLAAPTTDDPVSGPEKREDAKKRRGRPHKEKP
QANLSSSPNPGEPCNHLNATGGSGALSEPELVPEAEQKPKESPLPITLSVGDLVWTKVSG
YPWWPCMVTSDPEINCHFKQKQKASSSKTGALYHVQYFGDAPERGYIFEKNMVPFTGEDQ
YQDLCQCKKKPASRSVHKKMAPSVPRKLRAQWNMGIIQANEALSMSVEERMANFLFLYDD
KGPHLNPHIMEKLKPEPGLDHGAGLRLQPDHRSPPADPLGDLTAHFSNSTSAALQPQPDA
QDPHAAAASPADAPQKKRRRSKQAQTPQKTARRKKSAAENSSDPVKKRRKSKPSPSAEEA
PGSVSAAPSVPGQWEVEPQQSPVRQRGAKSDLLACSGEGVKKRQKKSLPDKQRTDSTAEH
EPRTSSKRPLSDDTAEKGPGVKKRRKMNKEAEKETIKTPRNQRGGEKENRMERTRLQPPR
QRRGGRPRVPSLRSLGVKDVQTPPATAWTVQRRENVRKSLSARWVRAGRVSFGGAGLLCS
NHVLFFLIFFLSPQSCEEAGEDLVPCEGQCCGMFHLQCLGVLLEPDDKVLCQECSTGVHS
CFHCKKSEGSVRRCHVPHCGKFYHEACIRLNPLTVFDNKGFRCPLHTCLGCCYGNRTKPK
STKGRLMRCLRCPVAYHAGDLCVAAGSEMVTSAAIICTNHFNAKKAYRHHSHVNVSWCFV
CSKGGRLLCCESCPAAFHPDCLNIAMPDGSWFCNDCRAGKKPKYRDIIWVKLGKYRWWPA
EIYHPRNIPTNIQHLRHEIGEFPVFFFGSRDYFWTHQGRVFPYMEGDRGSKYQRTGIGKV
FKHALLEAEARFKEIKMKREKKEAQQYSRKPPPYKFIKVNKPVGKVQVYAADISEIPKCN
CKPSDERPCGFESECLNRMLQYECHPQVCPSGERCCNQDFTQRLYPDTKIIKTPGKGWGL
ITLRDIKKVSARRPGSPVPVFLPVGRRVGTSWSDVTQGEFVNEYIGELIDEEECRARIKY
AQENNITNFYMLTIDKDRIIDAGPKGNYSRFMNHSCQPNCETQKWTVNGDTRVGLFAVCD
IPAGTELTFNYNLDCLGNEKTVCCCGAPNCSGFLGDRPKNSNGHTAEPKAKRGKKKYKKR
KSEGKKKSEDECFRCGDGGQLVLCDKKTCTKAYHLSCLNLTKRPFGEKNRHRYRRVGYLE
GTLALAGGVGDVLTNETERPPVLLQDAGTAPGTTATSVGRTRRPSASSAPTPSVSPTRRG
RCGLLPSRDSCAVRSTRSWTSRPAKVRTRRLKGTLRARPAPSAVLPKAPKPNPRAPRGKQ
SEL
NT seq 4332 nt NT seq  +upstreamnt  +downstreamnt
atggacagcaaagggagctccctgccttccatgcctgaaccagccaaccccatcagcatg
aagcagctgccagagcccctcagcgttcgcaaaaatggaggagacatgagcagcgaccat
tctatgctgatagacaaagctgctgctcatctggccgccacgctacaggacagcgtcctg
cagaagatggccagccacagccacagcaaccacagccacgagaggctcaaagacctcacc
tctctcgtgctgaacggggaccaggacgcgcttcccaagctttgcactccagagcagtcg
ttgctgaagagcgctgaagtacccaccgccaatgggacccacccgcgcaaccgcagcccc
cacagcgaacccgagctgaaggtaacgattccccaggtggtcaagcagcagccgcagctc
gaacccagctctgccaatggcaccagtctggccgcccccaccaccgacgatcccgtatct
ggaccggagaagagggaggatgcaaagaaaaggagggggaggccacacaaagagaaaccg
caggcaaacctcagctcctctcccaaccccggggagccgtgcaaccatttaaatgctaca
ggaggaagtggagcgctcagtgagcctgagctcgtcccggaggcagaacagaaacctaaa
gagtcccctctgccgatcacgctctctgttggggatttagtgtggacaaaggtgtcggga
tacccctggtggccttgcatggtgacctctgaccccgaaatcaactgtcacttcaaacag
aagcagaaagcgtccagcagcaagaccggcgccctctaccatgtgcagtattttggagat
gcgccagagcgaggctacatctttgagaagaacatggtgcccttcacaggagaggaccag
taccaggatctgtgccagtgtaaaaagaagccagcgtcacgcagcgtccacaagaagatg
gctccctcggtgccccgtaagctcagggctcagtggaacatgggcatcattcaagccaac
gaggccctcagcatgtcggtggaggagcgcatggcaaacttcctgttcctctatgacgat
aaagggcctcacctaaacccccacatcatggagaagttaaagcccgagcccggcctggat
cacggcgccgggctccggctgcagcccgaccaccgctccccaccggcggatcctctcggc
gatctcaccgctcacttctccaacagcacgtcggcagcgcttcagccacagccggacgcc
caggatcctcacgctgctgcagcctcaccagctgacgcgccccagaaaaaaaggaggagg
tctaaacaggcacagacgccccaaaaaacagccaggaggaaaaagtctgcagcagagaac
agttcagaccctgtgaagaagaggcgtaaatcaaagccgagtccttcagcagaagaagct
ccggggtccgtgtcagcggcgccttcggttcctggtcagtgggaggtggaacctcagcag
tcccccgtcaggcagagaggcgcaaaatctgatctgttggcttgttcaggtgaaggtgtc
aagaagaggcagaagaagagtcttcctgataagcagaggacggattccacagctgagcac
gagcccaggacgtcctccaagaggccgctctctgatgacacagcagaaaagggtccaggg
gtaaaaaagaggcgcaagatgaataaagaggcagaaaaagagacgatcaagacgccgaga
aaccaaagaggaggagaaaaagaaaacaggatggagagaaccaggctccagcctccaagg
caaagaagaggaggtcgtccccgtgtcccgagcctgaggtctctgggagtgaaggacgtc
cagactcccccagcgacagcctggacggtacaaagaagggagaacgtaagaaagagtttg
tctgccaggtgggtccgagctgggagggtctcctttggaggagcgggcctgctttgttct
aaccacgttctctttttcctgatattctttctttcccctcagtcctgtgaggaggccggc
gaagacttggtgccctgcgaaggtcagtgttgtgggatgtttcacctccagtgtctgggc
gtgttgttggagccagacgacaaggtgctgtgtcaggagtgcagcacaggagttcactcc
tgtttccactgtaagaagtcggagggctcggtgcggcgctgtcacgtccctcactgcgga
aagttctaccacgaagcgtgcattcgcctcaacccgctcaccgtgtttgacaacaagggg
ttccgctgcccgctgcacacctgcctgggctgctgctacggcaaccggaccaaacccaag
tccaccaaaggcaggttaatgcgctgcctgcgctgccccgtggcgtaccacgctggcgac
ctgtgtgtggctgcggggagcgagatggtcaccagcgccgccattatctgcaccaaccac
tttaatgccaagaaggcctacagacaccacagccacgtcaacgtcagctggtgcttcgtc
tgctctaaagggggacggctgctgtgctgcgaatcctgccccgcagcctttcaccccgac
tgcctcaacatcgccatgcctgacgggagctggttctgcaacgactgccgagccggaaag
aagcccaagtacagagacatcatctgggtgaaactaggaaagtacaggtggtggcctgca
gagatctaccatcccaggaacatccccaccaacatccagcaccttcggcacgagatcggg
gagttccccgtcttcttctttggttccagggactacttctggacccaccagggcagagtc
tttccgtacatggagggagaccgaggcagcaagtaccagaggaccggcatcggcaaagtc
ttcaagcacgctttgttggaagctgaagctcgattcaaggagatcaagatgaagagggaa
aagaaggaagcccaacagtacagccgaaaaccgccgccgtacaaattcatcaaggtcaac
aaacccgtgggcaaggtccaggtgtacgccgccgacatctccgagatccccaagtgcaac
tgcaagccgtcagacgagaggccgtgcggcttcgagtcggagtgtctgaaccgcatgctg
cagtacgagtgccacccccaggtgtgtcccagcggggagcgctgctgcaaccaggacttc
acccagcggctctacccagacaccaagatcatcaagacccctggaaagggctgggggctc
atcaccctgagggacatcaagaaggtgagcgcgcgccgtcccggaagtccggtcccggtt
ttcctcccggtcgggaggcgagtcgggacttcctggtctgatgtgacgcagggcgagttt
gtcaacgagtacatcggcgagctgatcgacgaagaggagtgccgggcgaggatcaagtac
gcccaggagaacaacatcaccaacttctacatgctcaccatcgataaggaccggatcatc
gacgccgggccgaaggggaactactcgcgcttcatgaaccacagctgtcagcccaactgc
gagacgcagaagtggacggtgaacggagacacgcgcgtcggcctgttcgccgtctgcgac
atcccagcaggaactgagctgaccttcaactacaacttggactgtctcggcaacgagaaa
accgtctgttgctgcggcgctcccaactgcagcggtttcctaggcgaccggccgaagaac
tccaacggccacacggctgagcccaaagcaaagcgcgggaagaagaagtacaaaaagagg
aaaagcgaaggaaagaagaagtcggaggacgagtgttttcgctgcggcgacggaggtcag
ctggtgctctgcgacaagaagacctgcaccaaagcttaccacctgtcctgcttgaacctc
accaagagaccttttggtgagaaaaaccgccaccgttaccgcagagttggttacctagag
ggaacgctggcgttggctgggggtgtgggcgacgtcctaacaaatgagactgaaaggcct
cctgtgctcctgcaggacgctgggactgcccctggcaccactgcgacgtctgtgggaaga
actcggaggccttctgccagctctgccccaactccttctgtaagtcccaccaggaggggg
cgctgcggccttctcccctcacgggacagctgtgctgtcaggagcacgaggagctggacg
tcccgcccggccaaggtcaggacgaggcgtctgaaaggaacactacgagcacggccggcg
ccctcggccgtcctcccaaaggctccaaagccaaacccaagagctccaagaggaaagcag
agtgagctttga

DBGET integrated database retrieval system