KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00024111G001Help
Entry
GSTEN00024111G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Brite
KEGG Orthology (KO) [BR:tng00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:tng01002]
    GSTEN00024111G001
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tng04147]
    GSTEN00024111G001
   04090 CD molecules [BR:tng04090]
    GSTEN00024111G001
Enzymes [BR:tng01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     GSTEN00024111G001
Peptidases [BR:tng01002]
 Metallo Peptidases
  Family M2
   GSTEN00024111G001
Exosome [BR:tng04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GSTEN00024111G001
CD molecules [BR:tng04090]
 Proteins
  GSTEN00024111G001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2 Peptidase_M32
Motif
Other DBs
NCBI-ProteinID: CAG04404
UniProt: Q4S4M8
LinkDB All DBs
Position
2
AA seq 1144 aa AA seqDB search
QVNATLEDQAFTEAWGLKAKTTFSSSLDLLSNSEKKMMSKIKVLGSANLPLNEREEYNTI
LSNMERIYSTAKVHPEPNVSWSLEPDLTEIMANSRSYKKLLFAWEGWHNESGAPLRADYE
KFVRLSNKASAADGFTDTGDYWRSWYESDTFEQDLEDLYKTIQPLYQNLHAFVRRKLYNQ
YGPKYINLKGPIPAHLLGNMWAQTWNNLYELMIPFPDKPNIDVTKEMLAQGYNATHMFRV
AEDFFESLNLDGMPDEFWEGSMLVKPTDREVVCHASAWDFYNRKDFRIKQCTTVTMEQLF
TVHHEMGHIQYYLQYKHQPVGFRRGANPGFHEAIGDVLSLSVSTPKHLHSIKLLDSLVTD
SEMDTNYLLKMALEKIAFLPFGYLIDQWRWGVFSGRTPPEKYNSEWWFLRTKYQGICPGT
KRTEAHFDPGAKFHIPGNTPYIRYFVSFILQFQLHEKLCEAANHTGPLHRCDIYRSAEAG
AILKNILQAGSSKAWPDVLQDAIGVNKLNASALMKYFKPITDWLEIQNENETLGWPEISW
VPPIPEGYPGDIGMNTDEADAVMLLTDYNSTAEVVWNAYTEASWKYNTDINKDNEDAMLK
KNLEMSAHTLEYGQKARKYDTTDFQDASVKRIIEKLSDIERAALSKDELEEYNTLLSSME
TKYSVATVCREGGPCLPLDPDLQKIMAESRDYDELLFAWKGWRESAGKVLRQDYKRYVEL
ANKAATLNGHTDNGAFWRSLYETPTFEQDLEVLWKDLEPLYHNVHAYVRRALYKKYGPKR
INLKGPIPAHLLGNMWAQTWSGIMDLVIPYPDATQVDATPAMVEQNWNATRMFQESDRFF
TSLGLEPMPQEFWDKSMLEKPSDGRKVVCHASAWDFYNRKDFRIKQCTVVTMDDLITVHH
EMGHVQYFLQYKDQPVSFRDGANPGFHEAIGDVLALSVSTPKHLKSIGLLDKVENNYESD
INFLLSMALDKISFLPFGYLMDQWRWKVFDGRISSSEYNKEWWNLRMKYQGLCPPIARTE
EDFDPGAKFHIPANVPYVRYFVSFVIQFQFHKALCEAAKHNGSLHTCDIYQSKEAGKLLG
DVMKLGASKPWPEAMAMMTGQPKMSAKPLMEYFSPLIDWLEKQNKENNDILGWPEYDWKP
ENSS
NT seq 3432 nt NT seq  +upstreamnt  +downstreamnt
caggtaaatgctaccctggaagaccaggcctttacagaagcatggggtttgaaggccaag
acgactttcagttcttctttggacttacttagcaattctgagaagaaaatgatgagcaag
attaaagtattgggttctgctaatctgcccctgaatgaaagagaggagtataacacaatt
cttagcaacatggagcgcatttattctacagccaaggtgcatccagagccaaacgtaagc
tggagccttgagcctgatcttactgagatcatggcaaattctaggagctacaagaaactg
ctgtttgcctgggaaggctggcacaatgaatctggtgctcctctcagggcggactacgag
aagtttgtgaggctcagtaacaaagcctctgcagccgatggatttacagacactggagac
tactggcgttcctggtatgagagtgacacctttgagcaggatctcgaggatctttacaaa
accatacaacccctctatcaaaacctgcatgcctttgtgagaaggaagctctacaaccaa
tatggccccaaatatatcaaccttaaaggtcccatccctgcccacctgctaggaaacatg
tgggcccagacttggaacaatctttatgagttgatgattccatttccagacaagcccaac
atagatgtgaccaaagaaatgcttgcccaaggctataacgccacccacatgtttcgtgtg
gctgaggatttcttcgaatctctgaatttagatggcatgcctgatgagttctgggaagga
tcgatgctggttaagcctacagatcgagaggtggtgtgccacgcgtctgcatgggacttt
tacaaccgtaaagactttagaatcaagcagtgcaccacagtaacgatggaacagctcttt
actgttcaccatgagatggggcatatccagtattatttacaatacaaacatcagccggtg
ggcttcaggcgcggagccaacccaggtttccacgaggccattggcgatgtcttgtcactt
tccgtttccacaccaaaacatctgcattccattaaactcctggactctctggtcacagac
tccgaaatggacaccaactacctgctaaagatggctctggaaaagatcgctttccttcct
tttggttacctcattgaccagtggagatggggtgtgtttagtgggcgcacacctcctgag
aaatacaattctgaatggtggttcctcaggacaaagtatcaaggtatctgcccaggcacc
aagcgaactgaggcgcactttgatcctggagcaaagttccacatccccggaaacacacca
tatatcaggtattttgtcagttttattctgcaattccaacttcatgagaaactgtgtgag
gcagcaaaccacaccggtcccctgcatcggtgtgacatctaccgctctgcagaagcagga
gccattttgaagaatattcttcaagctggatcttccaaagcttggcctgatgtgcttcaa
gatgccattggggtcaacaaattgaatgcctcggccctgatgaaatactttaaaccaatt
actgactggctggaaatacaaaatgaaaatgagacactaggttggcccgaaattagctgg
gttccacccattcctgagggttaccctggggatattggcatgaatacagatgaagctgat
gcagtgatgttactcactgattacaacagcacagcagaagtggtgtggaacgcttacact
gaggcctcttggaagtacaacactgacatcaataaagacaatgaagacgcgatgcttaaa
aaaaatctggagatgtcagctcacacactggaatatggacaaaaagcccgcaagtatgac
accaccgacttccaggacgcctcagtgaaacgcatcatcgaaaagctgagtgacattgaa
agagcagcactgtccaaagatgagctggaagagtacaatactctcctatccagcatggag
accaagtacagtgtagctactgtctgcagagaaggggggccatgtcttccattagatcca
gatcttcagaagatcatggcagagtccagggactatgatgaacttttgtttgcctggaaa
ggatggagagaatctgccgggaaagtgcttcgtcaagactacaaaagatatgttgagctg
gccaacaaagccgcgacactcaatggtcacaccgacaatggcgcattctggcggtccctg
tatgaaacccctacctttgagcaagacttggaggttctgtggaaggacctggagccactc
tatcacaacgtccatgcgtatgttcgcagggctctgtacaaaaagtacggtcctaaacgc
atcaacctgaaagggcccatccctgcacatttgctggggaacatgtgggcacaaacctgg
tctggaataatggatttagtcattccctacccagatgccacacaggttgatgctactcca
gccatggtggaacagaattggaacgccaccagaatgtttcaggaatcagacaggtttttc
acctcgctgggcctggaaccaatgcctcaggagttttgggacaagtccatgctggagaag
ccttctgatgggcgtaaggtggtgtgtcatgcctcagcgtgggacttttataaccgaaaa
gacttcaggatcaaacagtgcacagttgtgaccatggacgacctgatcacagtacaccat
gagatgggccacgtgcagtattttctgcagtacaaagaccagcccgtgtccttccgtgac
ggagccaaccctggcttccatgaagccattggtgatgtcctggccctgtctgtgtccaca
cccaaacatctgaaaagcatcggcctcctggacaaagtggaaaacaactatgagagcgat
atcaacttcttgctgagcatggcacttgacaagatttctttcctaccttttggctacctg
atggaccagtggagatggaaggtgtttgatggacgtatctcatcatctgagtacaataaa
gaatggtggaacctcaggatgaaatatcagggactgtgcccacccattgcccgcacggag
gaggattttgacccaggtgctaagttccacatccctgctaacgtgccttatgtgaggtac
ttcgtcagctttgtcatccagtttcagttccacaaggctctgtgtgaagctgccaagcat
aatggatctcttcatacctgcgacatctaccaatctaaagaggctgggaagctcctgggt
gatgtgatgaaactaggtgccagcaagccctggccagaggcaatggccatgatgactggc
cagccaaaaatgagtgccaagccactgatggagtattttagtcctcttattgattggctg
gagaagcagaacaaggagaacaatgatattcttgggtggcctgagtacgactggaaacct
gaaaactcgagt

DBGET integrated database retrieval system