KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00024925G001Help
Entry
GSTEN00024925G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng00480  Glutathione metabolism
tng00980  Metabolism of xenobiotics by cytochrome P450
tng00982  Drug metabolism - cytochrome P450
tng00983  Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:tng00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    GSTEN00024925G001
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    GSTEN00024925G001
   00982 Drug metabolism - cytochrome P450
    GSTEN00024925G001
   00983 Drug metabolism - other enzymes
    GSTEN00024925G001
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tng02000]
    GSTEN00024925G001
Enzymes [BR:tng01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     GSTEN00024925G001
Transporters [BR:tng02000]
 Other Transporters
  Pores ion channels [TC:1]
   GSTEN00024925G001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_3 GST_C GST_C_2 Glutaredoxin MazG-like
Motif
Other DBs
NCBI-ProteinID: CAG05035
UniProt: Q4S2U7
LinkDB All DBs
Position
17
AA seq 239 aa AA seqDB search
MSTEKCYSKGSAAPGPVAKDHIRLYSMRFCPFAQRTKLVLIAKGIKHDTININLKDKPDW
FLEKNPLGLVPTLETAAGEVIYESPITCEYLDEVYPEKKLLPSTPFGKAQQKMMLEHFSK
ITPYFYKITMGRKNGDDVSGLEAELKEKMGKLNEDLDKKKTKYFGGDSITMIDYMMWPWF
ERMEVFGLKCCLDNAPELTKWTERMREDPAVKATSHSPDTHRAFYKTYTDGKPDYDYGL
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgtcaactgaaaagtgttactccaagggcagtgctgctccgggtccagtcgccaaagac
cacatcaggctgtacagcatgagattctgcccatttgctcagaggacaaaattggtgttg
attgccaaagggatcaagcatgatacgatcaacatcaacctcaaagataaacccgactgg
ttccttgagaagaatcctctcggtctggtcccgaccctggagacagctgctggagaggtg
atatatgaatcccccatcacctgtgagtacctggatgaagtttaccctgaaaagaaactg
cttccctccaccccttttggtaaagcgcagcaaaaaatgatgcttgagcatttttccaag
ataactccatacttctacaagatcacgatgggaagaaaaaatggtgacgatgtctctgga
ctggaagcggagctaaaagagaagatgggaaaattaaatgaggacttggataagaagaag
accaagtattttgggggtgattccatcacaatgatcgactacatgatgtggccgtggttt
gagaggatggaggtctttggactgaagtgctgccttgacaatgcacccgagctgacaaag
tggactgaacgcatgcgagaggacccagcggtcaaagccacctcgcacagtcctgacaca
cacagggccttctacaaaacatacactgatggcaaacctgactacgactatggtctg

DBGET integrated database retrieval system