KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00025004G001
Entry
GSTEN00025004G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K22745  apoptosis-inducing factor 2
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:tng00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    GSTEN00025004G001
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox DAO Pyr_redox_3 Lycopene_cycl GIDA FAD_oxidored FAD_binding_3 FAD_binding_2 K_oxygenase NAD_binding_8 Amino_oxidase Thi4 HI0933_like AlaDh_PNT_C
Other DBs
NCBI-ProteinID: CAG05093
UniProt: Q4S2N9
LinkDB
Position
17
AA seq 371 aa
MGGQVSTADVHVVVVGGGFGGISAALQLQSRGLSFTLVDMRDSFHHNVAGLRASLLPGFA
NRTFIPYVNTFGDRFVQGRVEHIDPERRVVVLEGGREIQFTHLILSTGTDGAFPGRFVQA
ASHQSAVQAYQDFIGQVQAADSVLVIGGGSTGVEMAAEIRTEYPEKKVVLVHSKMQLADP
GLLPIVRYQAKEVLLEKGVQVLLGHKVANLSELKLNVTTKNMQVLTDKGERINADLIICC
TGLRVNSSAYQSSFSDHMTESGALKVNEHLQVEGSAHIFAIGDCNDVDEAKTAYNADRHA
SVAVGNIVNSVSGRRLAAYRTGNVTMLLAMGRDDGVGQVNGFQLPRCLVALFKSRDLLLW
KSWKDMRQKQP
NT seq 1113 nt   +upstreamnt  +downstreamnt
atggggggccaggtgtccacggctgatgtccacgttgtggtggtgggtggaggcttcggg
ggcatctctgcggccctccagctccagtcccggggcctgagcttcaccctggtcgacatg
agggactcttttcatcacaacgtggctggtctgagagcctctctgctgcctggcttcgcc
aacaggacgttcatcccgtatgtgaacacgtttggggaccgcttcgtccagggccgagtg
gagcacatcgacccagagcgacgggtcgtggtcctggagggaggacgggagatccagttc
acccacctcatcctgtctactgggacggatggcgcgttcccggggaggttcgtccaggcg
gcgtctcaccagagcgccgtgcaggcgtaccaggatttcatcgggcaggtccaggctgca
gactcggttctggtgattggaggcgggtcaaccggagtggaaatggcggctgaaatcagg
actgaatatccggagaagaaggtggttctggtccactccaagatgcagctggccgaccca
gggttgctgcccatcgtccgctaccaggccaaagaggttctgctggagaaaggagtccag
gttctgctgggacacaaagtggccaatctgtcggagctgaaactgaacgtgaccaccaag
aacatgcaggtgctgacggacaagggagaacgcatcaacgcggacctgatcatctgctgc
accggcctgagggtcaacagctcagcctaccagtccagtttctcggatcacatgactgag
agcggcgctctgaaggtcaacgagcacctgcaggtggaaggatccgcccacattttcgcc
atcggcgactgcaacgacgtggacgaagccaagacggcgtacaacgcagaccggcacgct
agcgttgccgttggcaacatcgtcaacagcgtgagcgggaggcggctagcggcctatcgg
acaggcaacgtgaccatgctgctggccatgggcagagacgacggcgtgggccaggtgaac
ggattccagctgccgcgctgcctggtggctctgttcaagagccgggacctgctgctgtgg
aagagctggaaggacatgaggcagaaacaaccg

DBGET integrated database retrieval system