KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00025637G001
Entry
GSTEN00025637G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K05461  KIT ligand
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04010  MAPK signaling pathway
tng04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:tng00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    GSTEN00025637G001
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    GSTEN00025637G001
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:tng04052]
    GSTEN00025637G001
Cytokines and growth factors [BR:tng04052]
 Growth factors
  Growth factors (RTK binding)
   GSTEN00025637G001
SSDB
Motif
Pfam: SCF
Other DBs
NCBI-ProteinID: CAG05577
UniProt: Q4S1A5
LinkDB
Position
13
AA seq 234 aa
MATALCALSRSADIRIRSCVHLLLFITLGVHSSKFDVNPVTDDISRLSILKNNIPKDYRI
PLDYIPKATGGMCWVKLNVFCLENSLHNLSHTFGNISSNRKNLSIFIKMFQELRFNLEPV
EPIMYEFDCHYRKEWWYTAQYFDLIKEFLIAAQNGDTSDDCEPPPCPTTPQPESTEEYLT
DHEPSALSEVVERSLLSLLFIPLLAMVFLLVWKVRLMLTLGMSSAQHLKIRLEV
NT seq 705 nt   +upstreamnt  +downstreamnt
atggctaccgccctctgcgcgctgtcccgctccgccgacattcggatacgcagttgtgtc
catttactgctgttcatcacgcttggggtacattcaagtaaatttgacgtcaacccggtg
acagatgacatctctagactctctattctgaaaaacaatattcctaaagactacagaatt
cctctggattacattccaaaagcaacgggcgggatgtgttgggtaaaattaaacgtcttc
tgcttggagaacagtttgcacaatttatcgcatacgtttggaaacatctcatccaacagg
aaaaatttaagcatattcatcaaaatgttccaagagctgcgcttcaatttggagcctgtg
gaaccaatcatgtacgaatttgactgccactacaggaaagagtggtggtacacagcacag
tactttgacttgatcaaagaatttctcatagccgcacaaaatggagacacttctgacgac
tgcgaacctcctccctgtcccaccacaccacaaccagaatccacagaagaatatttaaca
gaccatgaaccaagcgccctgagcgaggtggtggagcggagccttctttctttactcttc
atcccactcttagccatggttttcctgcttgtgtggaaggtgagattgatgttgactctt
ggcatgtcatctgctcagcatcttaagataagactagaagtgtga

DBGET integrated database retrieval system