KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00026281G001
Entry
GSTEN00026281G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K07207  tuberous sclerosis 2
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04115  p53 signaling pathway
tng04140  Autophagy - animal
tng04150  mTOR signaling pathway
tng04218  Cellular senescence
tng04910  Insulin signaling pathway
tng05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:tng00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    GSTEN00026281G001
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    GSTEN00026281G001
  09143 Cell growth and death
   04115 p53 signaling pathway
    GSTEN00026281G001
   04218 Cellular senescence
    GSTEN00026281G001
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    GSTEN00026281G001
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    GSTEN00026281G001
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:tng01009]
    GSTEN00026281G001
Protein phosphatases and associated proteins [BR:tng01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     GSTEN00026281G001
SSDB
Motif
Pfam: Tuberin DUF3384 Rap_GAP
Other DBs
NCBI-ProteinID: CAG06050
UniProt: Q4RZY2
LinkDB
Position
18
AA seq 1788 aa
MNKQSSKESLRDKVKGIFGLGPPRPPSKHSDSKSSEFIITSDLLKELHPDCGLSSRIRTL
HQVCDLAKTKKFEEHAVEAVWKSVEDMLSPEQPPEARHAVLQLLRAVIQGQGEWLGPLRA
YFFKVIRDYQPCNEDLSDRLEVFKALTENGKDIIYLEEDIAQFVLLWMDIGLTSDFLHVL
VNLVKFNSCYLDQNVSIMVQKICLLCNRTTSSTDIEVALQVLDAVVCYNCLPSDSLTIFI
ITLCRTVNVKEFCEACWKLMRKVLGTHLGHSAIYTMCRIMEEKVYTEDAPLLRGAVFFVG
MALWGAHRLPALKNTPTLVLPSFYKAMSSANEVVSYEIVLSITRLIKKYGKELQVVTWDI
LLGIIERLLQQIQTIGSAELKAIVYELLTTVEELYEQNGYHGSTEKFFNLVEKCADKRPV
SVVLSHIFPPSFSQTTTPANAASLAGIGSIRADPHLIQSPVDTAGQGWVDSESPSPHGEV
LPDELIESVVIPQLSGIAEDRDLAVRKQATQLLVDLAEGCSTHHFSSLLDIIERVRRVAR
RSFRLQPDGGFISFLPSSAQVASRSLVCSGTLEVSERDPTAESAMEDVRTAVLGLLEILQ
SKLYSLPASHASRVYELLISHLQLHYKNKYSSPIASSIRLQVFDFFLMMRADSLHRIGVP
NKDRALRFSPYCYCDSGEPEKRGSEKKAAGSTSPPVGSPAPPPAPSSSGSVRSAYLPYAP
AYSVLLQCLKMETDWKVLKLVLDKLPWMLQYKVLLLTSPCSLDHLCSTLCCMVTDRLISE
RLKKTPEGFSRTDVQLAVVPVLTAITSYHNYLEQPRQRELVQCLETGLIHRCTKQCVVAL
TMCTVEMPDIMIKLLPSLIVKLTHISATVAMASPMLEFLSTLVRLPHLYANFVAEQYVSV
FAISLPYTNPSKFNQYIVSLAHHVIAMWFIRCRLPFRKDFVQYITKGLRSNALLPFDDSH
EQSSFRARSTSLNERPKSLRAAKVVKATAAVANNSSSPAKELRDLSAMDAFRSRSISVSE
HAVRRMHTSTTTCSLGSADENAVTQADEGLKTVHLELTETCLDMMARYVFSNFSALPKRS
PIAEFLLAGGRSMTWLVGNKLVTITTSGGVRTQALLGLDVAERLGGGGGGGGGGGGGEMT
RSDPSLHTRITKEAPASLESQSSQQQNRATRTRVRSMSGQPESGRVCPHAHSGLGRDLHT
ETIRQHELADVSGEPTQPFLLGTRQHAAAGAVERAHGHGGREGTPDRDGQRSRQHRGRGA
APRPRAAAPERRPHPALQHRLGGGAGGGCGSLRSAVHSRLGGQRGLWAGGLSPHLHVCRQ
TLEDPPAWIAQQDPSRGLLQSSHGVPVRQRRPVVVQDAVGGQAPTSAAGEDRGDPDGRQR
TGGSRSGKRRPRGRRRAHEVGVSSSTGATGPRLPQRGPPTPGAHHFSVSALLQEGEENGQ
RRVPRPIRAGQRGESSGLSPRLVSKAPPQTLGGGRSVCLHLSRSSPSSSASSSSSSITPL
SSETKPTSRCCSPKPRPVDRAVKVLDQMPPYDTHKIGLVFVGAGQVRAPDHFCLHRPVTF
SDPPPPPLSLSFLGSLLSQVNNEVAILSNEYGSIPYAAFLTGLGKLIHLKDCDPDQIFLG
GLDQYGDDGEFTYCWHDDIMQVLNQLVSAAIFHIATLMPNRESDKGCCNKKRHIGNDFVI
VVYNDSGEEYKLGTIKGQFNFVEVIIKPLDYECNLVTLQCRKDLEGLVDTSVSKIVSDRN
LPLLVRQMALHANMASLVHQNRANPSDAYASKWLARLRHIKRIRTRVK
NT seq 5364 nt   +upstreamnt  +downstreamnt
atgaataagcagtccagcaaggagagtctgagggacaaggtgaaggggatctttggactg
ggacctccacgcccaccaagtaaacacagcgacagcaaatcctcggagtttatcattacg
tctgacctcctcaaggagctccacccagactgtggcctgagcagccggatccgtacgctg
caccaggtgtgtgatcttgccaaaaccaaaaagtttgaagagcatgcagtggaggcagtg
tggaaatctgtggaggacatgctgtctccagagcagccacctgaagccagacacgctgtc
ctgcagcttctgagggcagttatacaggggcagggcgagtggctcggaccactgagggct
tactttttcaaggtgatcagagactaccagccgtgtaatgaggacctctccgatagactg
gaagtcttcaaggctttaactgaaaacggcaaggacatcatatacctggaggaggacata
gcacaatttgtcctcctctggatggacatcggactcacatctgacttcctccatgttctt
gtaaacctggtgaagttcaacagctgctacttggaccaaaatgtctccatcatggtccag
aaaatttgtctcctgtgcaacagaacgacatcttcaactgatattgaggtggccctacaa
gtcctggatgcggtcgtgtgctacaactgcctaccttcagactccctcaccatcttcatc
attaccctttgtcgtacagtgaatgtgaaggagttctgtgaggcttgctggaagctgatg
aggaaggtgttggggactcaccttggtcacagtgccatctacaccatgtgccgcatcatg
gaggaaaaggtgtacacagaggacgcaccattattaagaggagccgttttcttcgttgga
atggccctgtggggcgcacacaggctccccgcccttaagaacacgcctacactcgttctg
ccatctttctacaaggccatgtccagtgccaacgaagtggtgtcctacgagatcgtactc
tccatcaccagactcatcaagaagtatggcaaagagctgcaggtggtcacctgggacatc
ctgctgggaatcatcgagaggctcctgcagcagattcagaccataggcagtgcagagctg
aaggctattgtctatgaactgttgaccaccgtggaggagctgtacgagcagaacggctac
catggctccacagagaagttcttcaacctggtggagaaatgtgccgacaagaggcctgtc
agtgttgttctgtcccatatttttcccccgtcattctcgcaaaccaccacccctgctaac
gctgcgtctctggctggaataggatccatccgtgctgaccctcatctcatacagagccca
gtcgatacagccggccaaggttgggtggattcagagtctccatcgcctcatggagaagtt
cttccggatgagttgatcgagtcggtcgtgatccctcagctcagcggcatagctgaagat
cgggacctggccgtcagaaagcaggctactcagctgctggtcgacctcgccgagggctgc
agcacacaccacttcagcagcctgctcgacatcattgagcgagtacgcagggttgctcgg
cgtagcttccggctgcagccggatggtggatttatttcctttcttccctcttctgcgcag
gtggccagccgctctctggtgtgttcaggaaccctggaggtttctgagcgggaccccaca
gcggagtctgctatggaggatgtcagaactgctgttctgggcctactggaaatcctgcag
agcaaactttacagccttccagccagccacgctagccgtgtgtacgagctgctcatcagc
cacttgcagctccactacaagaacaagtactcctcccctattgcttccagtattagacta
caggtgtttgacttcttcttaatgatgcgagccgactcgctccaccgtatcggagttccc
aacaaagacagagccttgaggttcagcccttactgctactgtgacagcggggagccggag
aagcgagggagtgaaaagaaagccgcgggttcaacttctccccctgtgggcagccccgct
cccccacctgctccctcctcgtcgggctcagtacgttcagcctatctgccctatgcccct
gcctacagtgtcctactgcagtgcctcaaaatggaaacggattggaaggtgctgaaactg
gttctggacaaacttccctggatgcttcagtataaagtgctgctgctcacttcaccgtgc
agcttggaccatctttgctccacactctgctgcatggtgacggatcggctgatatcggag
cgcctgaagaagacccctgagggattttcccgcactgacgtccagctggcggtggttccc
gtcctcacagccatcacgtcctaccataactacctggagcagcccagacagagggagctg
gtccagtgccttgagaccggtctcatccaccgctgtaccaaacagtgcgtggtggccctc
acaatgtgcacggtggagatgcccgacatcatgatcaagctcctcccatccctaattgtc
aagctcacccacatctcggcaaccgttgccatggcgtctcccatgctcgagttcctctcc
actctggtgcgcctgcctcatctctacgccaactttgtagccgagcagtacgtcagcgtg
tttgccatctctctcccctataccaacccttccaaatttaaccagtatatcgtgtcgctg
gcccatcacgtcattgccatgtggttcatacgctgcagactccccttccgcaaggacttt
gttcagtacatcacaaagggtttgcgctccaacgccctgctgccgttcgatgacagccac
gaacaaagttcttttcgcgcgaggagtaccagcctcaacgaaagacccaagagtctgcgg
gcagcaaaggtggtgaaggcgacagcagccgtagccaataacagcagctcacccgctaaa
gagctgagggacctgtcagccatggacgctttccgctcccgcagcatcagcgtctctgaa
catgcagttcgcaggatgcacacctccaccaccacctgcagcctgggctcggccgacgaa
aacgcagtgacgcaagcggacgagggcctgaagacggttcacctggagctgacggaaacc
tgtctggatatgatggccagatacgtcttctccaacttctccgccctgccaaagaggtcc
cccatcgcagagttcctgttggcaggaggtcgcagcatgacgtggctggtggggaacaag
ctggttaccataacgaccagcggaggggtcagaactcaagctctgctcggcctggatgtg
gctgaacgcttggggggaggaggaggaggaggaggaggaggaggaggaggtgaaatgacc
aggtcggatccgtctctgcacacccggatcactaaagaggctccagccagtctggagtcc
cagtccagccagcagcaaaacagagccacgcgcacaagagtccgctccatgtcaggacaa
ccggagtctggcagagtttgtccccatgctcactcagggctgggcagagatcttcatacg
gagaccatcaggcaacacgagctggctgatgtgtctggagaacccacccagccctttctc
ctcggaactcggcaacatgccgctgcaggagctgtcgagcgtgctcatggccatggaggg
cgtgaaggaacccccgaccgagacggccagcgctcccgccagcaccgcggccgcggcgcc
gccccccgtccccgagccgccgctccagaacgccggccccatccagcgctccaacaccga
ctcggtggtggtgctggaggagggtgcgggtctctccggagcgccgtccacagccgcctg
ggtggacagcgaggactttgggccggtgggctctcaccccatttacatgtctgcagacaa
accctcgaagacccccccgcctggatcgctcagcaggacccttcccgaggccttctccaa
agcagccatggagtcccagtccgccagcggagacctgtcgtggtccaggacgccgtcgga
gggcaggcccccacctcagccgcgggagaagaccgaggggaccccgacggacgccaacgg
actggaggctctcggtcagggaagcgaaggccccgcggtaggcgccgggcgcatgaggtt
ggagtttccagcagcaccggcgcaaccgggccccgtctcccccagcgggggccaccgacc
ccgggggcacaccatttcagtgtcagcgccctcctccaggagggagaggagaacggacag
agacgcgtaccacggccgatccgggccgggcaacgcggagaaagctccggcctgagcccc
aggttagtgtccaaagcccccccacagacgctgggggggggtcgaagtgtctgcttgcac
ctcagcaggtcctctccttcttcctcagcttcgtcttcctccagctctatcactcccctt
tcttcggaaacgaagccaacaagccgctgctgctccccaaaacccaggccagtcgatcgt
gccgtgaaggttctggaccagatgcctccgtacgacacccacaagattggcctggtgttt
gtgggcgccggtcaggtgagggcgccggatcatttctgcctgcaccggcctgtgactttt
tctgacccccccccccctcctctttctctctctttcctcggctcccttctttcccaggtc
aacaacgaggtggccatactgtccaacgagtacggttccataccgtacgccgccttcctg
acaggactgggcaagttgatccacctgaaagactgcgaccccgaccagatcttcctgggg
gggctggaccagtacggagacgacggcgagttcacctactgctggcacgacgacatcatg
caggtcctgaatcagctggtctctgcagctatctttcacatcgccacgctgatgccgaac
cgggagagcgacaaaggatgctgcaacaaaaagcgacacattggcaacgattttgttatc
gtggtgtacaacgactccggagaggaatataagctgggaaccattaagggccagtttaac
tttgttgaagttattattaaacccctcgactatgaatgtaatctcgtgactctccagtgc
cgcaaagaccttgaaggtctggtggacacgagcgtgtcaaaaatcgtgtcggaccggaac
cttcccctcttagtcaggcagatggctctgcacgcaaatatggcctctttggtgcatcag
aacagagccaacccctctgacgcgtacgcttccaagtggctggccagactgcgacacatt
aagaggatcagaaccagggtaaaa

DBGET integrated database retrieval system