KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00026524G001
Entry
GSTEN00026524G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K04503  G1/S-specific cyclin-D1
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04068  FoxO signaling pathway
tng04110  Cell cycle
tng04115  p53 signaling pathway
tng04218  Cellular senescence
tng04310  Wnt signaling pathway
tng04340  Hedgehog signaling pathway
tng04371  Apelin signaling pathway
tng04510  Focal adhesion
tng04530  Tight junction
Brite
KEGG Orthology (KO) [BR:tng00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    GSTEN00026524G001
   04340 Hedgehog signaling pathway
    GSTEN00026524G001
   04371 Apelin signaling pathway
    GSTEN00026524G001
   04068 FoxO signaling pathway
    GSTEN00026524G001
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    GSTEN00026524G001
   04115 p53 signaling pathway
    GSTEN00026524G001
   04218 Cellular senescence
    GSTEN00026524G001
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    GSTEN00026524G001
   04530 Tight junction
    GSTEN00026524G001
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-ProteinID: CAG06237
UniProt: Q4RZE5
LinkDB
Position
undetermined
AA seq 292 aa
MGEKLLCCEVDSIRRAQQDVNLLTDRVLLTMLKAEEHYLPSPNYFKCVQKEILPKMRKIV
ATWMLEVCEEQKCEEAVFPLAMNYLDRFLSVEATRKTRLQLLGAACMFLASKMKETVPLS
AEKLCIYTDNSVRLGELLQMELLVLSKLKWDLASVTPHDFIEHFLSKLRIFPSTKHVLRK
HAQTFVALCATDVNFIASPPSMVAAGSVVAAVQGLDLKSLNASFSSQNLTNLLSQVIGSD
PDCLRACQEQIESLLVSSLQQAQHHSSTTEPKRVSADADLSCTPTDVRDVNI
NT seq 879 nt   +upstreamnt  +downstreamnt
atgggggagaagctgctgtgctgcgaggtggactccatcaggagagcccagcaggacgtc
aacctgctcaccgaccgggtcctcctcaccatgctgaaggcagaggaacattatttgccc
tccccgaactactttaagtgcgtgcaaaaagaaatcctgcccaaaatgaggaaaatcgtc
gccacatggatgttggaggtttgtgaagaacagaaatgtgaggaggcggtttttcctctg
gctatgaactatttggacagatttctatccgtagaagctaccaggaaaactagactacaa
cttctgggggctgcttgcatgtttcttgcatcaaagatgaaggagacggtgccattgtca
gcggaaaaactctgtatctatacggacaactctgtccgcctcggagagctgctgcaaatg
gagctgttggttctgagcaaactgaagtgggacttggcttcagtaacgccacatgatttc
atcgagcacttcttgtccaagctgaggatcttcccgtccaccaagcacgtcctgagaaag
catgctcagactttcgttgctctttgtgccacagatgtcaacttcattgcaagtcctcca
tcaatggttgcagcaggcagcgtagtagcagctgtgcagggtctcgatctgaagagcctc
aatgcctcattttcctctcagaaccttacgaacctgctatcacaggtcatcggcagcgac
ccggactgcttgcgcgcctgtcaagagcagatcgagtctctcctggtgtccagcttgcag
caggctcagcaccacagcagcaccacagaaccaaaacgcgtgtccgctgacgcagacctg
tcctgcaccccaacggacgtgagagatgtcaacatctga

DBGET integrated database retrieval system