KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00027332G001
Entry
GSTEN00027332G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04012  ErbB signaling pathway
tng04068  FoxO signaling pathway
tng04110  Cell cycle
tng04115  p53 signaling pathway
tng04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:tng00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    GSTEN00027332G001
   04068 FoxO signaling pathway
    GSTEN00027332G001
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    GSTEN00027332G001
   04115 p53 signaling pathway
    GSTEN00027332G001
   04218 Cellular senescence
    GSTEN00027332G001
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-ProteinID: CAG06834
UniProt: Q4RXP8
LinkDB
Position
11
AA seq 187 aa
MFTPDDLKTRTLFNKNRTSSVHFTTITSGSLGPLGNGSARRNLFGPVDRDQLRVECQDAL
SKDLEEASRRWGFDFISDKPMENSHFQWEGVPGSQVPLVYRSCTLEPQQPARAAEATLKA
KGSRVPGSPSEKENIPCSPKRCPMEVESLEKTPEKRESTVLKRKQTNITDFYQAKRRVVG
MPRKSGE
NT seq 564 nt   +upstreamnt  +downstreamnt
atgtttacgccagacgacctaaaaactagaactttattcaacaaaaatcggacttcttct
gtgcatttcacaacaatcacaagcggatccctggggcccctggggaacggctctgcccgc
cggaacctctttggtccggttgaccgggaccagcttcgggtggagtgccaagacgccctg
agtaaagacctggaggaggcttcacggcgctggggcttcgacttcatctccgacaaaccc
atggagaacagccattttcagtgggaaggcgtccccggaagccaggtcccgctggtctac
aggtcctgcacgctggagccgcaacagcccgcgagggcagcagaggcgacgctcaaggcc
aaagggagcagggtccctgggtcgcccagcgagaaggagaacatcccgtgttcacccaag
agatgcccgatggaggtggagagcctggagaaaacccctgagaaaagggagagcacggtg
ctgaagaggaaacagacaaacatcacagatttctaccaggctaagaggcgagtcgtcggg
atgccccgcaaatccggcgagtga

DBGET integrated database retrieval system