KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00027404G001
Entry
GSTEN00027404G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K09850  Ras association domain-containing protein 1
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
SSDB
Motif
Pfam: Nore1-SARAH RA C1_1 C1_2
Other DBs
NCBI-ProteinID: CAG06899
UniProt: Q4RXI3
LinkDB
Position
11
AA seq 348 aa
MNDRMSKWELIELKDLSVNDPIELADAPQKASRAHPGQPSPFQVVRLVGDSVRIEAPRFH
TGDAAGGHDFQPCGRTHLTWCDLCGEFIWGLSKQSLRCSYCSYTCHFRCQPFIQLNCSTD
RKLLTEEEEPTAESLERDTNVDEDIGWRKHEVTVTEIQHQIKEYNSQTNSNLNMVFNKDG
TYTGFIKVHFHLARPISLPPHGGEAAQGGWGGRRTSFYLPKDTARHLHVSSQTRVGEVIQ
ALLNKFTLVDNPAKFALFEHTETQSQAYKRKLRDDECPLYLRLCAGPSEKAMSLVLKEND
TGDINWDAFSFPELCNFLRILKREEEEHVRQIVRRYALARDMMKQAMA
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgaacgacaggatgtctaaatgggagctgatcgagctcaaggacctcagcgtgaacgac
cccatcgagctggccgatgctccacagaaggcctcgcgggcacacccgggtcagccgagc
cccttccaggtggtgcgtctggtcggggacagcgtcagaatcgaggcgccgcgctttcac
accggagacgccgcgggtggtcacgacttccagccctgcggtcgcacccatctcacgtgg
tgtgacctctgtggagaattcatctggggtctttccaagcaaagcttgcgctgcagctat
tgcagttacacttgtcactttcgctgtcagccattcatccaactaaactgcagcacagac
agaaaattattaacagaagaggaagaaccaacagctgagtctttagaaagggacacaaac
gtggacgaagatattggttggagaaaacatgaggtgacagtcactgaaatccaacaccag
attaaagagtacaactcgcagaccaacagcaacctcaatatggtgtttaataaagacggg
acgtacacaggtttcatcaaggtccatttccacttggcccgtccgatctcgcttcctcca
cacgggggcgaggctgcgcagggcggctgggggggccggaggacgtccttctacctgccc
aaggacacggccagacacctgcacgtcagctcccagacccgggtaggagaggtgatccag
gccctgctcaacaagttcaccctggtggacaacccagccaagtttgctctgttcgaacac
accgagacacaaagtcaagcgtacaagcggaaactgcgagatgacgaatgtcccctctac
ctgcgcttgtgtgccggccccagtgaaaaagctatgagcctcgttttaaaagagaatgac
acaggagacataaattgggatgcgtttagttttcccgagctgtgcaactttctgagaatc
ctgaagcgtgaggaagaggagcatgtgcgtcagattgtgcggcgctatgcccttgctaga
gacatgatgaagcaggccatggcc

DBGET integrated database retrieval system