KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00027441G001
Entry
GSTEN00027441G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K08774  transforming growth factor, alpha
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04010  MAPK signaling pathway
tng04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:tng00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    GSTEN00027441G001
   04012 ErbB signaling pathway
    GSTEN00027441G001
SSDB
Motif
Pfam: EGF Laminin_EGF EGF_2
Other DBs
NCBI-ProteinID: CAG06933
UniProt: Q4RXE9
LinkDB
Position
11
AA seq 86 aa
VAAAVWSHFAECPDSHRHFCLHGSCRFLTLEETPACVCHQGFVGMRCEHADLLAVVATNH
RQTVTTVLVLCVIACVLVMVLCTLLQ
NT seq 258 nt   +upstreamnt  +downstreamnt
gtggccgccgcagtctggtcccactttgccgagtgtccggactcccaccgacacttctgc
ctccacggctcatgtcgcttcctgaccctggaggagacgcctgcgtgcgtctgccaccag
ggcttcgtcgggatgcggtgcgagcacgccgacctgctcgccgtggtggcgacaaaccac
agacagacggtcaccaccgtgctggtgttgtgtgtgatcgcttgtgttctcgtcatggtt
ttgtgtacgctgctacag

DBGET integrated database retrieval system