KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00027524G001
Entry
GSTEN00027524G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K09850  Ras association domain-containing protein 1
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
SSDB
Motif
Pfam: RA Nore1-SARAH DUF5383 Ras_bdg_2 DUF5111
Other DBs
NCBI-ProteinID: CAG06999
UniProt: Q4RX83
LinkDB
Position
11
AA seq 263 aa
ETPSFEMTWGSSTSSGYCSEEDSDSEFEQFFTARTSFFPKPRKANANANDKKDERVDAVK
EEFTTAELQQKVKEYNAKVNSNLFMNSNKDGSYTGFIKVQFKLARPVSVPPPKKGAHDSR
GRKGGGVKRRTSFYLPKDASKHLHISSRTSSREVIEALLKKFTVVDNPAKFALFERSERH
DQVYIRKLSDSERPLRLRLNAGPNEKVLSFVLKENETGEVNWHAFSMPELKNFLRILQRE
EEEHIKQIVQRYALARTRMQEAL
NT seq 789 nt   +upstreamnt  +downstreamnt
gaaacgccgtcctttgaaatgacctggggaagctccaccagcagcggctactgcagcgag
gaggactcggactccgagttcgagcagttcttcaccgcccggacatctttcttccccaaa
ccccggaaagctaacgctaatgctaacgacaagaaggatgaacgggtggatgctgtgaag
gaggagtttaccactgcagagcttcagcagaaggtgaaggaatataacgctaaggtcaac
agcaacctcttcatgaattcgaacaaagatggttcctatactggtttcatcaaagtgcag
ttcaagctggccagaccagtgtctgtccccccgccgaagaagggcgctcatgacagccga
ggtaggaagggaggcggagttaagcgccgcacttctttctacctgccgaaagacgcgtcc
aagcacctgcacatcagctcgcgtacgtcctcccgcgaggtcatcgaggctctgctgaag
aagttcaccgtggtggacaaccccgccaagtttgctctgtttgagcgcagcgagcgccac
gaccaagtttacatcaggaagttgtctgacagcgagcggcccctccgtctgcggctgaac
gccgggcccaatgagaaggtcctgagctttgttctaaaagagaacgaaacaggagaagtc
aattggcatgccttctccatgcctgagctgaagaacttcttgcgcattctgcagcgtgag
gaagaggagcacatcaagcagatcgtgcagcggtacgccctggcccgcaccaggatgcag
gaggcgctg

DBGET integrated database retrieval system