KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00027576G001Help
Entry
GSTEN00027576G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K05687  protein DJ-1 [EC:3.5.1.124]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Brite
Enzymes [BR:tng01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.124  protein deglycase
     GSTEN00027576G001
Peptidases [BR:tng01002]
 Cysteine Peptidases
  Family C56: PfpI endopeptidase family
   GSTEN00027576G001
Exosome [BR:tng04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GSTEN00027576G001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DJ-1_PfpI ThiJ_like GATase_3
Motif
Other DBs
NCBI-ProteinID: CAG07041
UniProt: Q4RX41
LinkDB All DBs
Position
11
AA seq 189 aa AA seqDB search
MAAKRALVILAKGAEEMETVIPVDIMRRAGIAVTVAGLTGKEPVQCSRNTVICPDASLED
DSKQGPYDVVLLPGGMPGAQNLAESAAVKEVLKDQDGRKGLIAAICAGPTALLAHGIGYG
STVTTHPAMKEKMMTGDHYKYSEARVQKDGHYITSRGPGTSFEFALTIVEELMGAEVAAQ
VRAPLMMKD
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggcagcaaaaagagccttagttatcctggctaaaggtgcagaggagatggaaactgtc
attcccgtggacatcatgcggagagcagggattgcggtgacggttgcaggtttgacggga
aaagagccagttcagtgcagcagaaacactgtcatttgtcctgatgccagccttgaggat
gacagcaaacagggaccatatgatgttgttctcctgccaggaggaatgccaggtgcccag
aatctggcggagtctgctgcagtgaaggaggtgctgaaggatcaggatggcaggaagggc
ctaattgcagccatctgtgcaggtcccaccgctctgctggcccatggcatcggatatggc
agcacagtcactacacatcctgctatgaaggagaagatgatgactggagaccactataaa
tattcagaggctcgagtacagaaggatggacattacatcaccagccgtgggccaggcacc
agttttgaatttgccttgacaattgtggaagagctcatgggggcagaggttgcagctcaa
gtcagagctcctcttatgatgaaagactga

DBGET integrated database retrieval system