KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00027778G001Help
Entry
GSTEN00027778G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng00052  Galactose metabolism
tng00500  Starch and sucrose metabolism
tng01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tng00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    GSTEN00027778G001
   00500 Starch and sucrose metabolism
    GSTEN00027778G001
Enzymes [BR:tng01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     GSTEN00027778G001
    3.2.1.20  alpha-glucosidase
     GSTEN00027778G001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 Trefoil DUF5110
Motif
Other DBs
NCBI-ProteinID: CAG07202
UniProt: Q4RWN0
LinkDB All DBs
Position
undetermined
AA seq 1715 aa AA seqDB search
TSSEMRATLKRMAAPSLFGADVQTLLFHAEMQTKNRLRFKIYDGQKTRFEVPHEHVKTVR
NNPSSPLNTVLEVKGQPFGLTVRRRESKKTLFDTTFAPLVFDDQYLQFSAKLPSHNIYGL
GEHVHRQYRHNTDWRTWPIFTRDGFPNGGTHNLYGHYPFFLCLEDESGKSFGVFLMNSNA
MEVTLQPAPAVTYMTIGGILDFYIFFGDTPEQVVQEFLELIGRPVIPPYWSLGFQLSRWN
YGSLAEVKKTVERNRAVEIPYEIQYTDIDYMEDKKDFTYDKVKFAGLPEFADYLHAKGQK
YILILDPAIATSKRVGNASYGSYDRGTAKNAWVFESDGKTPLLGELNQLCQSRAMAIGYN
VQSVAMVMGCSMPSVVMVMGCSVTCHHSDGLQCASVVMGCSLAVVRLICGCWAEPVSLVS
LTQRPLMADLSHWQVWPGQTVFPDYTSESCIEWWVDEYKRFSEEIKHDALWIDMNEVSNF
KKGSVTGCETNKLNYPPYTPKILDEVMYSKTLCMDAQQAWGNHYDVHSLYGYSMVLASER
ALQSVFGGNRSLLLTRSSFPGVGKYSGHWLGDNAANWNDIKWAIPGMLEFGLFGVPYIGA
DICGFFDDSSEELCRRWMQVGAFYPFSRNHNAENYKPQDPASYGANSLLVATSKHYLRIR
YTLLPYLYTLFYKAHTTGDTVVRPVMHEFYSDSQTWGIDRQFLWGKHLLITPVLDPGVDT
VRTYIPDAVWYNYETMERLNARGTLVDLYLPADKLGLHIRGGAILPTQEADLTTTYSRRK
PMGLIVALDDNKQAAGELFWDDGDSRATVDTGKYIHYEFSVISVRCFSLLYVLHSHLPPG
LGSRTSMWSLAKRAGSAGVQNLSKSAIFSQGKLQMRVTKAGYTDPNNLKFENITILGVPY
PPTSIAVSSTGRDGASTNMSTYTEYYDSEKKVLFLRDLSLTLGNNHLVTWELPSEDSQRF
NCHPEDNADESKCVARGCIWKPSSLEKAPWCFYPEDYGYSVTTSQETSSGMTANIIRNKK
YRSSGRPNSADIDLLRVQIYYHTSHMLQFKIWDPATDRYEVPVELSLPKTPETDESKRLY
KVVITQNPFGIQVIRKSTGTKIWDSSVPGFTFSEMFLQVSTRLPSSFIYGFGETEHPTYK
HDLNYHTWGMFTKDQPPGYKVNSYGMHPFYMGLETSANAHGVLLLNSNAMDVTLQPTPAL
TYRTIGGIMDFYMVLGPTPEMVVQEYTELIGRPVLPAYWTLGFQLCRYGYANDTEIEDLY
NSMRAAGIPYDVQYADIDYMERQLNFVLDKDFSNLPALVKRIQNEGGRFIIILDPAISGN
ETVPYPAFDRGVEDDIFIKWPKEIGDEIVWGKVWPDYPNVTVNESLDWDTQIKLYRSYTA
FPDFLRPATSNWWFREIKEFYENSMKFDGLWITGADICGFFNDAEYEMCLRWMHLGAFYP
YSRNHNGKGSRRQDPVAWDEEFANYSRDVLNIRYTLLPYLYTLMFEAHTKGNTVIRPLLH
EFVQDRNTWSIHKQFLWGPALLITAVLDKGVVSVDGYIPEARWYDYHTSKDIGVRGRILT
MDTPINHINLHVRGGYILPWQKPENSTYFSRKNPLGLIVALSDDGNAEGSLFWDDGEGID
NIKEKLYLLTSFTAKSNELSSQVLVNGLATADRPILGMLKVWGAGRTAITSATLKWGSEE
RQLTPQHNPETQELTLDATPLSVSLTQPFTVTWRT
NT seq 5148 nt NT seq  +upstreamnt  +downstreamnt
acatcttcagaaatgagagccaccctgaagaggatggctgccccctcgctcttcggcgct
gatgtacaaacgctgttgttccacgctgaaatgcagactaaaaatcgcctgcgttttaag
atctatgacgggcagaagacgaggttcgaggttccccatgagcacgtaaagacagtcaga
aataacccatccagcccccttaacactgtgctagaggtgaaaggtcaaccctttggcctt
accgtgcgccgcagggagagcaagaaaaccctgtttgacacaacatttgctcctctggtg
tttgatgaccagtaccttcagttttctgccaaactgccatcccataatatctatggcctg
ggcgagcatgtacacagacagtatcgccataacaccgactggaggacctggcccatcttc
accagagatggcttcccgaatgggggaacccataacctctacggacactatcctttcttc
ctctgcctggaagacgaaagtgggaaatcctttggcgtcttcctcatgaacagcaacgca
atggaggtgactttgcagcctgctcctgctgtgacctatatgaccatcggagggattctg
gacttttacattttctttggggacactcctgaacaggtggtgcaggagttccttgagctc
attggccggccagtcatccctccctactggtcactgggtttccagctgtctcgatggaac
tacggcagccttgcagaggtgaagaagacggtggagaggaaccgcgcggtggagattccc
tatgaaattcagtacacagacattgattacatggaggacaaaaaagatttcacctacgat
aaagtcaaatttgctggcctgccggagtttgcggattacctgcatgcaaagggacagaaa
tacatcctcatcctggatcctgctatagcaacaagcaagcgggtgggcaatgcctcgtat
gggtcatacgaccgggggactgcgaagaacgcctgggtgtttgaatctgacgggaagacg
ccgctgctgggagagctcaaccagctgtgtcagtctcgtgctatggcaataggctacaac
gtgcagtcagtcgccatggtgatgggctgcagtatgccatccgttgtcatggtaatgggc
tgcagtgtgacgtgtcatcatagtgatgggctgcagtgtgcgtctgtggtcatgggctgt
agtttggctgtagttcggctcatctgtggttgttgggcagagccagtgtctctcgtgagc
ctgacacagcgccccctcatggctgatctgtctcactggcaggtgtggccaggtcagacc
gtctttccagactacacaagtgaaagctgcatcgagtggtgggttgatgaatacaagcgc
ttctccgaggagatcaaacacgacgccctctggattgacatgaacgaggtgtccaacttc
aagaaaggatctgtgactggctgtgagactaacaaactcaactaccctccctacactcct
aagattctggacgaggtgatgtacagtaagaccttgtgtatggacgcccagcaggcctgg
gggaatcattacgacgtccacagtctctacggctactccatggtgctggcctctgagaga
gctctgcagagcgtctttggaggaaatcgcagcctgctgttgacccgctcctccttccca
ggtgttgggaaatattcaggccactggcttggagacaacgccgccaactggaacgacatt
aaatgggccatcccgggaatgctggagtttggcctctttggcgttccttatattggagcg
gacatctgtggattcttcgatgactccagtgaggagttgtgtcgtcgctggatgcaggtg
ggggctttctaccccttcagcaggaaccacaacgccgaaaactacaagccgcaggatcca
gcttcttacggtgccaactcactgctagtggccacctccaagcattacctgaggatccgt
tacacactgctgccttacctttacacactcttctacaaggcccacaccacaggagacacg
gtggtgcgtcccgtcatgcatgagttctactcagacagccagacttggggcatcgatcgc
cagttcctgtgggggaaacacctgctgatcacacctgttctggacccgggcgtggacact
gtgagaacgtacatcccagacgccgtgtggtacaactacgagacgatggaacgactgaac
gcgcgaggaacgctggtggacctgtacctgccagccgataagctggggctacacatcaga
ggcggagccatcctcccaacgcaggaagctgacctcaccaccacatacagccggcgtaag
cccatgggactgatagttgctctggacgacaacaagcaggcagcaggagagctgttctgg
gatgatggagactccagagcaactgttgacacgggcaaatacatccactacgagttctct
gtaatctcagtacgttgcttttctctcctctacgtcttacattcacatttaccgcctggt
cttgggtccagaaccagcatgtggagtctagctaaaagagcaggcagtgctggagtccag
aatctcagcaaatctgcaatcttttcacagggaaagctccaaatgcgagttaccaaagca
ggctacacggacccaaacaacctgaagtttgagaatataaccatcctgggtgtgccctac
ccccccacctccattgcagtgtcctccaccggcagagatggagcatctaccaacatgtcc
acgtacaccgaatactatgactctgagaagaaggttctgttcctgagggacctttcactg
accctggggaacaatcacctagttacttgggaactgccatcggaagattcccagcgcttc
aactgccatcctgaggacaatgcagatgaaagcaagtgtgtggccagaggctgcatctgg
aagcccagctccctcgagaaagccccctggtgcttctatcccgaggactacggctacagt
gtcacaacatcccaagaaacctcaagtggaatgacagccaacatcattcgcaacaaaaag
tatcgcagcagcggtcgtcccaactctgccgatattgacttgctgcgcgtccagatttac
taccacaccagtcacatgctgcagttcaagatttgggatccggccacagatcgttacgag
gttccagtggagttgtcacttcccaaaacccccgagactgacgagagcaagaggctctat
aaggtggttattacccagaatccttttgggatccaggtcataaggaagagcacaggaacc
aaaatctgggattcgtccgtgccaggattcaccttctccgaaatgttcctccaagtgtcc
actcgcctgccgtccagctttatctacggattcggtgagacagaacatcccacctacaaa
catgacctcaactaccacacctggggaatgttcaccaaggaccagcctccggggtacaaa
gtcaattcctatggaatgcatcccttctatatgggtctggagacaagcgccaatgctcac
ggcgtcctgctgttgaacagtaatgccatggatgtgactttgcagccaactccagcgcta
acctacagaacaattgggggcatcatggatttctacatggtcctgggacctacgcctgaa
atggtggtgcaggagtacacagaactgattggacgacccgttctacctgcctattggact
cttgggttccagctctgtcgctatggttacgccaatgacacagaaatagaagatctgtac
aacagtatgagggctgctggtattccctacgacgtccagtatgcagacatcgactacatg
gagcgccagctgaactttgtcctggataaggacttcagcaatctgcctgcactggtgaag
cgcatccagaacgagggtggcaggtttatcatcatcctggatccggccatctctggcaac
gagaccgtcccttaccccgcctttgacaggggcgtggaagatgacatcttcatcaagtgg
cccaaagagattggtgatgaaatcgtttggggaaaggtgtggcctgattatcccaatgtc
actgtgaatgaatcgcttgactgggacacccaaataaagttgtaccggtcctacacggcc
ttccctgacttcctgcgacctgccacatccaactggtggtttagagaaatcaaggaattc
tatgagaactccatgaagtttgacggcctgtggattaccggcgcagacatctgtggcttc
ttcaacgatgctgagtatgaaatgtgtcttcgctggatgcatctgggcgccttctaccca
tactcgcgcaaccacaatggcaagggcagccggagacaagaccctgttgcttgggacgaa
gagtttgccaattattctcgggacgttctgaacatccggtacaccctgctgccctacctc
tacacgctgatgtttgaagctcacaccaaaggaaacacagtcatcagacccttgctgcac
gagtttgtccaggacagaaatacctggagcatccacaaacagttcctgtggggacctgcc
ctgctgatcaccgccgtccttgacaagggagtcgtgagcgtggacggttatattcctgag
gctcgctggtatgactaccacacgagcaaagatatcggagtccgaggccggatcctcacc
atggacacaccaataaaccacatcaacctccacgtgcgcggaggttacatccttccctgg
cagaaaccggagaattccacctacttcagtcgcaagaatcctttaggactgatcgttgcc
ctgagtgacgatggcaacgccgaaggatcactcttctgggacgatggggagggaatagac
aacattaaggagaaactctacctgctgacctccttcacagctaagtcgaatgagctaagc
agccaggttctggtcaacggcctggccacagccgacaggcccatcctgggcatgctgaag
gtttggggcgccggcagaaccgccatcacatcagcaactctgaagtggggctccgaggag
cgccagctaacgccacagcacaacccggagacgcaggagctgacccttgatgccacgcct
ctgtcggtcagcttgactcagcctttcacggtaacatggaggacctga

DBGET integrated database retrieval system