KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00027855G001
Entry
GSTEN00027855G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K02091  cyclin-dependent kinase 6 [EC:2.7.11.22]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04110  Cell cycle
tng04115  p53 signaling pathway
tng04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:tng00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    GSTEN00027855G001
   04115 p53 signaling pathway
    GSTEN00027855G001
   04218 Cellular senescence
    GSTEN00027855G001
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tng01001]
    GSTEN00027855G001
Enzymes [BR:tng01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     GSTEN00027855G001
Protein kinases [BR:tng01001]
 Serine/threonine kinases: CMGC group
  CDK family
   GSTEN00027855G001
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo
Other DBs
NCBI-ProteinID: CAG07253
UniProt: Q4RWH9
LinkDB
Position
3
AA seq 313 aa
YELLAEVGEGTYGKVYKAREEGGEQRLLAVKKLHFRGDASEAGIPAAMVREVALMRKMKY
FNHPNVVKLLDVSVVPAGRSLDLSLVLEYVDQDLSTYLSKVPASGLSKDAIKDVMHQLLS
GLDFLHTNLVVHRDLKPENILVSSRREVKIADFGLARIYSFNMALTPGVSEASGRVRPAP
RRSSDYSRCLQVVTLWYRAPEVLLNSVYMFSVDMWSVGCIFAELFLLRPLFQGYTEAQQL
QKIFEVIGVPTEEDWPRDSPISYPSSFRPEGSCTKPLPSLGPQEHHLLSECLTFRPSSRI
SAAKALTHPFFTK
NT seq 939 nt   +upstreamnt  +downstreamnt
tacgagctgctggccgaagttggagaaggaacctacgggaaagtgtacaaggcccgcgag
gaggggggggagcagcgcctcctggcggtgaagaagctccacttccgcggggacgcgtca
gaggcggggatccctgcggccatggtccgcgaggtggcgctgatgcgcaagatgaagtac
ttcaaccaccccaacgtcgtcaagttgttggacgtttccgtggtgccggcaggcaggagc
ctggatctctctctcgtcctggagtacgttgaccaggacttgtccacgtacctgtccaag
gttccagcttctggactgagcaaagatgccatcaaggacgtcatgcaccagctgctgagc
gggctggactttctgcacaccaacctggtggtgcaccgcgacctgaagccagagaacatc
ctggtgagcagccgcagggaggtgaagatcgcagacttcggcctggcgcgcatctacagc
ttcaacatggctctgactccgggcgtaagcgaggcctcgggacgcgtccgcccggcgccg
cggcggtcatctgattactcccgctgccttcaggtggtgacgctgtggtacagagctccg
gaggtgctgctcaactctgtctacatgttctcggtggacatgtggagcgtcggctgcatc
ttcgccgagctcttcctgctgaggccgctgttccagggctacacggaggcgcagcagctg
cagaaaatcttcgaggtgatcggcgttccgacggaggaggactggcccagagacagcccc
atctcctaccccagcagctttcggccagaaggttcctgcaccaaaccgctgccaagtctg
ggaccacaagagcaccacctcctgtctgaatgtttgacgttcaggccgagcagtcgcatc
tccgccgccaaagcgctgacccatcctttcttcacgaag

KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00032981G001
Entry
GSTEN00032981G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K02091  cyclin-dependent kinase 6 [EC:2.7.11.22]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04110  Cell cycle
tng04115  p53 signaling pathway
tng04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:tng00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    GSTEN00032981G001
   04115 p53 signaling pathway
    GSTEN00032981G001
   04218 Cellular senescence
    GSTEN00032981G001
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tng01001]
    GSTEN00032981G001
Enzymes [BR:tng01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     GSTEN00032981G001
Protein kinases [BR:tng01001]
 Serine/threonine kinases: CMGC group
  CDK family
   GSTEN00032981G001
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Seadorna_VP7 FTA2 RIO1
Other DBs
NCBI-ProteinID: CAG11128
UniProt: Q4RKF4
LinkDB
Position
21
AA seq 427 aa
DTQYEQVAEIGEGAYGKVYKARDLKNGGRFVALKKVRVQTEEEGMPLSTIREVAVLRQLE
AFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLEKAPDPGVPPETIKVNVIIL
EKVSASSAVTIRWAPSFAGVHGLWIVDFREDPFDSLTSWWACEWSCGLRSMSLDMMYQLL
QGLDFLHSHRVVHRDLKPQNILVTSGGQIKLADFGLARIYSFQMALTSVWCAFILGFLSE
RECKHRPLAKLGRPRRCQHCSLGLIPVLVALGHGKERRERKENGRHGASDSEIHTQASAG
PVVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRRPLFRGNSDVDQLGKIFDVVGVP
SAEDWPQEVALPQSAFTPRPPKPIENLVPDMDEQGRTLLLQFLAFNPSRRISAFAALNHP
YFQSVDS
NT seq 1281 nt   +upstreamnt  +downstreamnt
gacactcaatacgagcaggtggccgagatcggcgaaggcgcttatgggaaagtgtacaaa
gccagagatttgaagaacggaggacgctttgtagcgctgaaaaaagtccgtgtccagacg
gaggaggaggggatgcctctctccacgatccgggaggtagcagttctgaggcagcttgaa
gccttcgagcaccccaatgttgtcaggctgtttgatgtctgtacagtctctcggaccgac
cgagaaaccaaactcactctggtctttgagcacgtggatcaggacctgaccacctatctg
gagaaggctcccgatccgggagtacccccggagaccatcaaggtaaacgtcatcattctg
gaaaaggtgtctgcaagcagcgcggtgaccatccgatgggctccctccttcgcgggggtt
catggtctttggattgtagattttagagaagacccctttgactcactcaccagctggtgg
gcctgtgaatggagctgcgggctcaggtccatgtcacttgatatgatgtaccagctgctc
cagggactggacttcctgcactcgcaccgcgtggttcaccgtgacctgaagccccagaat
attctggtcaccagcggaggtcagatcaaactggccgactttggtttagcccgcatctac
agcttccagatggcgctcacctccgtgtggtgcgctttcatcctgggcttcctcagtgag
agggaatgtaaacacaggcccctggccaagctcggccggccccggcgctgccagcactgc
agcctcggactcatccccgtcctcgtggcactgggtcacggcaaagaaaggagagagaga
aaggaaaatggtcgtcatggcgcctcagactctgagatccacacgcaggcttccgcaggg
cccgtggtaacgctgtggtacagagccccggaggtgctgctccaatccagttacgccacg
ccggtggacctgtggagcgtcggctgcatctttgccgagatgttcaggagaaggccgcta
tttagaggaaactcagatgttgatcagctgggcaagatttttgatgttgtcggggtgcct
tcagcagaagactggccccaggaagtggccttaccacagagtgccttcaccccccgaccc
cccaagccgatagagaatttggttccggacatggacgaacaaggacggaccctcttattg
caattccttgccttcaacccctccaggaggatatcggcctttgctgcgctgaaccacccg
tatttccaaagtgtggatagc

KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00033818G001
Entry
GSTEN00033818G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K02089  cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04110  Cell cycle
tng04115  p53 signaling pathway
tng04218  Cellular senescence
tng04530  Tight junction
Brite
KEGG Orthology (KO) [BR:tng00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    GSTEN00033818G001
   04115 p53 signaling pathway
    GSTEN00033818G001
   04218 Cellular senescence
    GSTEN00033818G001
  09144 Cellular community - eukaryotes
   04530 Tight junction
    GSTEN00033818G001
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tng01001]
    GSTEN00033818G001
Enzymes [BR:tng01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     GSTEN00033818G001
Protein kinases [BR:tng01001]
 Serine/threonine kinases: CMGC group
  CDK family
   GSTEN00033818G001
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like
Other DBs
NCBI-ProteinID: CAG11752
UniProt: Q4RIN0
LinkDB
Position
11
AA seq 299 aa
MKMAHGTSVQYEPVAEIGGGAYGTVYKARDTESGKFVALKSVRVQTDQNGLPVSTVREVA
LLRRLEQFDHPNVVRLMDVCATQRSEQETKVTLVFEHVDQDLKTYLEKAPAPGLPPGRIK
DLMRQLLCGLAFLHSNRVMHRDLKPENILVTSQGQVKLADFGLARMYSCHMPLTPVVVTL
WYRPPEVLLQSGYATPVDIWSTGCIFAEMFRRKPLFCGESEVDQLTKIIKVLGLPSEEEW
PTDVTLSRKNFPSVSPSPITDFVPEISESGAQLLLKMLTFDPAKRISALNALEHPYFQN
NT seq 897 nt   +upstreamnt  +downstreamnt
atgaaaatggcccacggcaccagtgtccagtacgagccagtggcggagatcggaggcgga
gcttacgggacggtttacaaggcccgggatacggagagcgggaagttcgtggcgctgaag
agcgtacgcgtccagacggatcaaaatggcctcccggtctccacggtccgagaagtggct
ctgctgcggaggctggagcagttcgaccaccccaacgtggttcggctcatggatgtgtgc
gccacccagaggtcggaacaggagaccaaagtcaccctggtttttgagcacgtggaccag
gacctgaagacgtacctagagaaagcccccgcgcccggattaccccccggtcgcatcaaa
gacctgatgcgacagctgctgtgcggtctcgccttcctccactccaatcgggtgatgcat
cgagacttgaagccggagaacatcctggtgaccagccagggccaggtgaagctggccgac
ttcggcctggccaggatgtacagctgccacatgccgctcacccccgtggtggtgaccttg
tggtaccggccaccggaggtgctgctgcagtccggttacgccacacctgtagacatatgg
agcaccggctgcatctttgccgagatgttccgacgcaaacctttattctgcggagaatcc
gaagtggaccaacttacgaagattatcaaggtcctcggcttgccttcagaggaggagtgg
ccaaccgatgttacgctgtccagaaaaaacttcccgtcggtctctcccagccccatcacc
gacttcgttccagagatcagcgagtccggagctcagctgttgttgaaaatgctgaccttt
gaccccgccaaacgaatctcggccctgaacgcgctagagcacccgtactttcagaac

DBGET integrated database retrieval system