KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00029591G001Help
Entry
GSTEN00029591G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K12407  glucokinase [EC:2.7.1.2]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng00010  Glycolysis / Gluconeogenesis
tng00052  Galactose metabolism
tng00500  Starch and sucrose metabolism
tng00520  Amino sugar and nucleotide sugar metabolism
tng00524  Neomycin, kanamycin and gentamicin biosynthesis
tng01100  Metabolic pathways
tng01200  Carbon metabolism
tng04910  Insulin signaling pathway
Module
tng_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
tng_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:tng00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GSTEN00029591G001
   00052 Galactose metabolism
    GSTEN00029591G001
   00500 Starch and sucrose metabolism
    GSTEN00029591G001
   00520 Amino sugar and nucleotide sugar metabolism
    GSTEN00029591G001
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    GSTEN00029591G001
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    GSTEN00029591G001
Enzymes [BR:tng01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     GSTEN00029591G001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-ProteinID: CAG08582
UniProt: Q4RSQ0
LinkDB All DBs
Position
12
AA seq 488 aa AA seqDB search
QVEQILSEFKLNTEDLSQVMKRMQREMERGLRLDTHEEASVKMLPTYVCSTPKGSEVGDF
LALDLGGTNFRVMLVKVGEDEEGSWKVETQKQMYSIPEDAMTGTAQMLFDYIAECMSHFL
DHHHMKHKKLPLGFTFSFPVRHEDIDKGILINWTKGFKASGAEGNNVVGLLRDAIKRRGV
SFSLLHQSPNCWFVLTGHFNSVPQDFEMDVVAMVNDTVATMISCYYEDRSCEVGMIVGEQ
THVQKCVAGTGCNVCYMEEMRTVELVEGEEGRMCVNTEWGAFGDNGELEDFRLEYDRVAD
EASINPGHQLYEKLISGKYMGELVRLVLMKLVNENLLFNGEASELLKTRGSFDTRFVSQV
ESDSGDRKQIYNILSSLGVLPSELDCDIVHLVCESVSTRAAHMCGAGLAGVINSMRVRRN
QEALVITVGVDGSVYKLHPCFRDRFHKIVRDLTPRCEITFLQSEEGSGRGAALISAVACK
MAACMLTQ
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
caggtagagcagatcctatcagagttcaagctgaatacagaagatctcagccaagtgatg
aagaggatgcagcgtgaaatggagagaggcctccgcttggacacacacgaggaggccagc
gtgaagatgctgcccacctacgtctgttccaccccaaaaggatcagaggtgggggacttc
ttggccttggatctgggcggaaccaacttccgcgtgatgctggtgaaagtgggtgaagat
gaggaggggagctggaaggtggagacgcagaagcagatgtactccattcctgaagacgcc
atgacgggcactgctcaaatgctctttgactacatcgccgagtgcatgtcccactttctg
gaccatcatcacatgaagcacaagaagcttcctctgggtttcactttctccttccctgtg
cgacacgaggacatcgacaagggaatcctgattaactggaccaaaggcttcaaagcgtct
ggtgcggaggggaacaatgttgttggtttactcagggacgccatcaagagacgcggggtg
agcttttcacttctccatcaaagtcccaactgttggttcgtgctaacggggcattttaat
tctgtcccccaggactttgagatggatgtggttgccatggtgaatgacacagtagccacc
atgatttcctgctattatgaggaccgcagctgtgaagtgggcatgattgtgggtgagcaa
acacacgtgcagaaatgcgtggccggcaccggctgcaacgtgtgttacatggaggagatg
aggactgtggagctggtggaaggggaggagggccggatgtgtgtgaacacagagtggggg
gcattcggggacaacggcgagctggaggacttcagactggagtacgacagagtggcggac
gaggcctccattaaccccggacatcagctctacgagaagctgatcagtgggaagtacatg
ggcgagctggtcagactggttctgatgaagctggtgaatgaaaacctgctgtttaacgga
gaggcctccgagctcctgaagacacgcggaagctttgacacgcgcttcgtctcgcaggtg
gagagtgacagtggggaccgtaagcagatctacaacatcctgtcctcgctgggcgtcctg
ccctctgaactggactgtgatatcgtgcatctggtctgtgagagcgtctccacgcgggcc
gctcacatgtgcggagcaggactggccggtgtcatcaacagtatgcgagtgcggcgcaat
caggaggccctggtgatcacggtgggagtggacggctccgtttacaagctccacccatgt
ttccgggacaggttccacaaaatcgtgcgggacctgacgccccgctgcgagatcaccttc
ctgcagtcagaggaggggagcggccgcggagccgctctcatctccgctgtggcctgcaag
atggctgcgtgcatgctgacgcagtaa

DBGET integrated database retrieval system