KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00029862G001
Entry
GSTEN00029862G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K10130  leucine-rich repeats and death domain-containing protein
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04115  p53 signaling pathway
tng04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:tng00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    GSTEN00029862G001
   04115 p53 signaling pathway
    GSTEN00029862G001
SSDB
Motif
Pfam: Peptidase_S68 ZU5 Death LRR_8 LRR_4
Other DBs
NCBI-ProteinID: CAG08777
UniProt: Q4RS55
LinkDB
Position
13
AA seq 822 aa
MEKSNNEVGGRDEVDKEQSDLTKAVLALRLPGRLVYRDEETSSGIICPGRTEDVEDDGDA
ASAALLSSTDTCALLIPCVPTHPHPSVSSSSSSSSSGLCLSPPLPPSVELASVLADTRLT
LDVYKGGAAALPLLWASIPEQLTGVQYLTLGSDDKEGLDDALDLVPHLTDLRTLAIRGSL
SSLRELFIYSNDIRVIPPCLNKLPLLKIDIRGNPLGRPPTPPPLPPAPDITSAGELSEMS
RISEQELTPRCSFCFFRFFVSPPGCHVFLPGGAELLFPPGCLSATRRIEWEEKRPEKKLV
HLEEHEILLSCPLELQPHGIKFLKPVEVCVPYHRPKRTEVVVLKFDGLSWSPLPTALRRG
SKHRSAYHRGRVPRFSWFMVVSRPVKDSCSLTSAGTLLVSSIDPGIKLHFLPDCTLENRT
VTLQVLQVSSAEVQALCGDPQAQVSPLLCLSQNPSTDFLQPVKVQVPLPPGVTGQTADMS
CLHLLHGDPSAQTWTDITSQVSLYVTHAYAVFYITHFSWYWLWYSTQKVICGTVRRIYQK
LKQFKVQFLVQQRKSDPSQVMLQCLPSNKVDSRVQSLSELYDGPQPSDVCDLLEGEQFFA
GFESGLDISTERPDCVEGRLCFVFYSSLRNLKEVYICAAEGQTGPVRGQVSFYRGEAPSH
LPEEVARKRKGPDHQWLATLPVKLPVAPLLWSQAHENGFVVGDRQHPPLNLGDPESGYLT
ESNLLSISLQIGHDWQVIGINLGLSYQELDRIKYKNRDNLGALVLDMLFHWARGQRTAGP
GAVSRLVTAMMESGRRDLADEIEDTVRIGRRKYSESLRRVGL
NT seq 2466 nt   +upstreamnt  +downstreamnt
atggagaaaagcaacaacgaagtgggcggccgtgatgaagttgacaaagagcagtccgac
cttaccaaggctgtcctagctttgaggctcccgggacggcttgtgtaccgggatgaggag
acgtcaagtgggattatatgtccaggccgaacagaagatgtggaggacgacggggatgct
gcgtctgcggctctcctcagctccacggacacctgtgctcttttgataccctgcgtcccc
acacatccacatcccagtgtgtcttcatcttcctcctcgtcctcctccggcttgtgccta
agtccccccttgcccccctctgtggagctggcgtctgtgttggctgataccaggctgacc
ctggatgtgtacaaaggaggagcggctgcgctgcctctgctgtgggcctccatcccagag
cagctaacaggagtccagtaccttacactgggatctgatgacaaagaaggcctggatgat
gcgctggacctcgtacctcatttgacagatctgcgcacactcgctattcgaggttctctc
tcttctctcagggagcttttcatctacagcaatgatattcgtgtcatcccaccttgtctg
aacaaactacccttgctaaaaatagacatacggggcaatcctttgggacggcctccgaca
ccccctcctcttcctcccgcacctgatataaccagcgcaggtgaactgtcagaaatgtcc
cggatctctgagcaggaactgacacctcgctgctccttttgcttttttaggttttttgtt
tcaccccctgggtgtcacgtgtttctcccaggaggggctgagctgcttttccccccaggg
tgcctgtcggcaaccagaagaattgagtgggaagaaaaaagaccagaaaagaagctggtg
caccttgaagaacatgagatcctgctgagttgtcccctggagctacaaccacatggaatt
aaatttttaaagcctgtagaggtgtgtgtgccttatcaccggcccaagagaaccgaggtg
gtggtgctgaagttcgatgggctgtcatggagccctctgcccacggctctgaggagggga
agtaaacaccgtagcgcttaccaccgaggccgagtgcccaggttctcctggttcatggtc
gtgtcccggccagtaaaggacagttgctctcttacatcagctggaactttgctcgtgagc
agcattgaccccggaataaagctccacttccttccagactgcaccttggaaaaccgcact
gtaaccttacaggtgcttcaggtgtcttcggcagaggtacaggctctgtgtggagaccct
caggcccaagtgagccccctcctctgcctctcccagaatccaagcacagatttcctccag
cctgtcaaagttcaggtccccctgcctcctggagtcacaggtcaaacagccgacatgtcc
tgtctccatctcctacacggagacccttcggcccaaacctggactgatatcacatcccag
gtgtctctctacgtcacccacgcctacgctgtcttctacatcacgcatttctcctggtac
tggttgtggtactccactcagaaagtgatttgtgggactgtgaggagaatctatcagaag
ctaaaacagttcaaggtccagtttctcgtccagcagcgcaaaagtgacccttcgcaggtc
atgctgcagtgtttaccttcgaacaaggtggacagcagggtgcagtctctgtcagagctt
tacgacgggccgcagccctcggacgtgtgcgacctgctggagggggagcagttctttgcc
ggcttcgagagcggcctggatatcagcacagagagaccggactgtgtggagggaagactg
tgcttcgtgttttactccagcctgaggaacctgaaggaagtttacatctgtgcagcagag
ggtcagacgggtcctgtgaggggccaggtgtccttctacaggggggaggcgcccagtcat
ctgccagaggaagtggccaggaagaggaaaggtcccgatcaccagtggctcgccacttta
ccagttaaacttccggtggctcccctgttgtggtcgcaggctcatgagaatggtttcgtt
gtgggcgatcgccagcatcctcctctgaacctgggcgatcccgagagcggctacctgaca
gaatccaacctgctgtccatctccctccagatagggcacgactggcaggtcatcggcatc
aatctcggcttaagctaccaggaactggatcgcatcaagtacaaaaacagggacaacctg
ggagctctggtgctcgacatgttgttccactgggccagagggcagaggaccgccgggccg
ggcgcggtgtcgaggctggtgaccgccatgatggagagcgggaggagggacctggccgat
gagatagaggacacggttcgaataggaaggagaaagtactccgagtctctgaggagagta
ggtctg

DBGET integrated database retrieval system