KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00030892G001Help
Entry
GSTEN00030892G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04010  MAPK signaling pathway
tng04068  FoxO signaling pathway
tng04110  Cell cycle
tng04115  p53 signaling pathway
tng04210  Apoptosis
tng04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:tng00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    GSTEN00030892G001
   04068 FoxO signaling pathway
    GSTEN00030892G001
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    GSTEN00030892G001
   04210 Apoptosis
    GSTEN00030892G001
   04115 p53 signaling pathway
    GSTEN00030892G001
   04218 Cellular senescence
    GSTEN00030892G001
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:tng03036]
    GSTEN00030892G001
Chromosome and associated proteins [BR:tng03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     GSTEN00030892G001
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     GSTEN00030892G001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L7Ae
Motif
Other DBs
NCBI-ProteinID: CAG09562
UniProt: Q4RPX0
LinkDB All DBs
Position
12
AA seq 159 aa AA seqDB search
MTLEEIRGQEKDMESADRVQSAGAALEELLVAAKKQDYITVGVYESAKVMNVDPDSVAFC
VLATDEEYQCDIALQIHFTLIQAFCFDNDVNVVRVTDIERLADIVGADETGESKDVHCIL
VTSPSANPWKNPALDKLGLFCEESRSVYDWVPTITLPER
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgactctggaggagatccgcggacaggagaaggacatggagagcgcagacagggtgcaa
agtgcgggcgcagccctggaggagctgctggtcgccgctaagaagcaggactatatcacg
gtcggcgtctacgaatccgccaaagtcatgaatgttgacccggacagcgtggcgttctgc
gtgctcgccaccgatgaggagtaccagtgcgacatcgccctgcagatccacttcacgctc
atccaggcgttctgcttcgacaacgacgtcaacgtggtgcgcgtcaccgacatcgagcgc
ctggccgacatcgtgggcgcggacgagaccggcgagtccaaagacgtgcactgcattctg
gtcacgagtccaagcgcgaacccgtggaaaaacccggctctggacaagctgggtctgttc
tgcgaggagagccggagcgtgtacgactgggtgcccaccatcaccctcccggagcgc

DBGET integrated database retrieval system