KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00031473G001
Entry
GSTEN00031473G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K04398  caspase 8 [EC:3.4.22.61]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04115  p53 signaling pathway
tng04210  Apoptosis
tng04217  Necroptosis
tng04620  Toll-like receptor signaling pathway
tng04621  NOD-like receptor signaling pathway
tng04622  RIG-I-like receptor signaling pathway
tng04625  C-type lectin receptor signaling pathway
tng05132  Salmonella infection
tng05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:tng00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    GSTEN00031473G001
   04217 Necroptosis
    GSTEN00031473G001
   04115 p53 signaling pathway
    GSTEN00031473G001
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    GSTEN00031473G001
   04621 NOD-like receptor signaling pathway
    GSTEN00031473G001
   04622 RIG-I-like receptor signaling pathway
    GSTEN00031473G001
   04625 C-type lectin receptor signaling pathway
    GSTEN00031473G001
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    GSTEN00031473G001
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    GSTEN00031473G001
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:tng01002]
    GSTEN00031473G001
Enzymes [BR:tng01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.61  caspase-8
     GSTEN00031473G001
Peptidases and inhibitors [BR:tng01002]
 Cysteine peptidases
  Family C14: caspase family
   GSTEN00031473G001
SSDB
Motif
Pfam: Peptidase_C14
Other DBs
NCBI-ProteinID: CAG09993
UniProt: Q4RNN9
LinkDB
Position
2
AA seq 245 aa
YPMTTLPRGCCLIISNYDFQGSGLGMRNGTRTDEECLKKVFEWLGFKVEIHRDCTGKEIL
SLMQELADKSQQRWDCLVCCILSHGLEGCVHGVDGDQVSIKKLIEPFLGTNCPAMAGKPK
LFFIQACQGKKQQGVVHLESDGAEHSDVDTDAVRLSNCIPSHADFLLGMATVPDYVSYRD
RERGTWYIQSLCEYLVKMVPRGFDLMSILTKVNEDVSKKNDNTGDRKQMPQPVFTITKRI
VFPVP
NT seq 735 nt   +upstreamnt  +downstreamnt
tatcccatgaccacgctgcccagaggctgctgcctcatcatcagtaactacgacttccaa
ggatccggtcttgggatgaggaatggcaccaggacagatgaagagtgtctgaagaaggtc
tttgaatggcttggcttcaaggtggagattcatcgggattgtacaggcaaagagattctg
tccctgatgcaggaattggccgacaaaagccagcagagatgggactgcctggtgtgttgt
attctcagccacggcctggaggggtgtgtgcatggcgtggacggagaccaagtcagcatc
aagaagctgatagaacctttcctcggaacaaattgccccgccatggctggaaaacccaag
ctgtttttcatccaggcctgccagggcaagaaacaacagggcgtcgtccacctggagagt
gacggggctgagcacagtgatgtggacaccgatgctgtccggctgagcaactgcatccca
tcccatgctgatttcctactgggaatggccacggttcccgattatgtgtcttacagagat
agggaaaggggaacatggtatatccagtcgctgtgcgagtaccttgttaaaatggtgcca
aggggttttgacctcatgtccatcctgacaaaagtgaatgaggacgtcagcaagaagaac
gataacactggtgataggaagcagatgcctcagccggtcttcaccatcactaagaggata
gtcttccccgtcccc

DBGET integrated database retrieval system