KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00032404G001
Entry
GSTEN00032404G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K22744  apoptosis regulatory protein Siva
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:tng00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    GSTEN00032404G001
SSDB
Motif
Pfam: Siva
Other DBs
NCBI-ProteinID: CAG10694
UniProt: Q4RLN8
LinkDB
Position
10
AA seq 169 aa
MPKRTCPFPETFSSQYKIHIGQQELNNYGVFGSKYRQEIYEKTKNLLFNGAKAVMGKIWT
SEEGIDERQPGGPVETSACQTLLRGQMLIGQNGKLMKANTAQSVSVSPTCCCVCQKSRRS
RTSCSQCDRLACSSCLRQCSSCSSLCCSVCTITDYSGQYDEVLCCSCST
NT seq 510 nt   +upstreamnt  +downstreamnt
atgccaaaacgaacatgtcctttccctgaaaccttttcgtcgcagtacaaaatacatatc
ggacagcaggagctgaacaattacggagtgtttggaagtaaatacagacaggaaatctac
gaaaagacaaagaacttgttgttcaacggtgccaaggctgtgatgggcaaaatatggacc
tcagaggagggaatcgatgaacggcagcccggcggacctgtcgaaacttctgcctgtcag
acgctgctaagagggcaaatgctaattggacagaatggcaaactcatgaaagcaaacact
gcacaaagtgtttccgtgtctccaacgtgctgctgtgtgtgtcagaaaagccggaggtcg
aggacttcgtgctcccaatgtgaccgtctggcctgttcctcgtgcttgcgccagtgctcc
agctgctccagcctctgctgctctgtgtgcacaatcacagattacagcgggcagtatgat
gaagtactgtgctgcagttgctcaacctaa

DBGET integrated database retrieval system