KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00032680G001
Entry
GSTEN00032680G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K10143  E3 ubiquitin-protein ligase RFWD2 [EC:2.3.2.27]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04115  p53 signaling pathway
tng04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:tng00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    GSTEN00032680G001
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    GSTEN00032680G001
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:tng04121]
    GSTEN00032680G001
Enzymes [BR:tng01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     GSTEN00032680G001
Ubiquitin system [BR:tng04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    GSTEN00032680G001
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     GSTEN00032680G001
SSDB
Motif
Pfam: WD40 zf-C3HC4_2 zf-C3HC4 zf-RING_UBOX zf-RING_2 zf-C3HC4_3 zf-RING_5 zf-C3HC4_4 zf-rbx1 zf_C2H2_10 zf-RING_10 Prok-RING_4 zf-RING_4 DZR
Other DBs
NCBI-ProteinID: CAG10910
UniProt: Q4RL22
LinkDB
Position
undetermined
AA seq 797 aa
SGSRKKAHHPTPLYNGLLNSYEDKSNDFVCPICFEMIEEAHMTKCGHSFCFKCIRQSLED
SNRCPKCNYIVDNVDQLYPNFLDAYIFFIDLFSAVSTCDAPEVNELILKQKQMSEEKRLK
LDHPNGSRWQIFQDALNPDQENLDLANVNLMLELLIQKKKQLEAHSEGQVWQMVVRQWCL
ETETPRSRQEAEMEMLRSSLGGTRVESFRIVNVRGTACVRCAGGGARLSLDMSRGGTVKM
PGRRFRKRPETGHVDLVREDMEVAGVTEADESFEESQAAQRQILMEFLKEARRNKKEQLE
QLQKELNFLEDDIKRVEEMSGLYSPMEAECTVPNVEAPSPAASCSSIIDPPDYNQPPGFG
GTNQGKRQTWYNSTLASRRKRLTAHFEDLEQCYFSNKMSHITEESRNMNQLDDFMECLAK
FTRYNSVRPLATLSYASDLYNGSSIVSSIEFDRDCDYFAIAGVTKKIKVFEYGTVIQDAV
DIHYPVNEMTCNSKISCISWSSYHKNLLASSDYEGTVILWDGFTGQKSKVYQEHEKRCWS
VDFNLMDPKLLASGSDDAKVKLWSTNLDNSVASIEAKANVCCVKFSPTSRYHLAFGCADH
CVHYYDLRNTKQPIMVFKGHRKAVSYAKFVSGEEIVSAQSLSEHNWPLLGPSRVPAHRGK
TRGHFYFCLDQTEMLAWLSSEDDVYRSTDSQLKLWNVSKPHCLRSFKGHINEKNFVGLAS
NGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDKDKKEDDTNEFVSAVCWRALPD
GESNVLIAANSQGTIKV
NT seq 2391 nt   +upstreamnt  +downstreamnt
tcgggcagcaggaagaaagcccatcatcccacccccctttacaacggcctgttgaactca
tacgaagataagagcaacgactttgtttgcccgatctgcttcgagatgattgaggaggca
cacatgacaaagtgtgggcacagtttttgttttaagtgtatccgccaaagcctggaagac
agcaacagatgccccaaatgtaactatattgtcgacaacgtggatcaactgtacccaaac
tttcttgacgcttacatcttttttattgatctcttctctgccgtttccacctgcgacgct
cccgaagtaaacgaactgatcctgaaacagaaacaaatgtccgaggagaagcggctgaag
ttggaccatcctaatgggtcgaggtggcagatattccaggacgccttgaatcctgaccag
gagaacctggacttggcaaacgtcaacctgatgctggagctcctgatccagaagaagaag
cagctggaggcgcacagtgaaggtcaggtgtggcagatggttgtgagacagtggtgcttg
gagacagagacaccgaggagcagacaggaggcagagatggagatgttgaggtcctctttg
ggaggaacgagggtggagagcttcaggatcgtgaacgtcagagggacggcatgcgtcaga
tgtgctggaggtggagccagactgagtttggacatgtccagaggagggacggtgaagatg
ccgggcaggaggttcagaaaaagacctgagactggacatgtggacctagttagagaggac
atggaggtagctggtgtcacagaagcagatgagtcttttgaggaatcgcaggcagctcag
aggcaaatcctgatggagttcctgaaagaagccaggagaaacaagaaagagcaactggaa
caactgcagaaagagttgaacttccttgaagacgacatcaagcgtgtggaggagatgagc
gggctgtactcgccgatggaggccgagtgcacggtgccaaacgtcgaggctccgtcacca
gcagccagctgcagtagtattatagacccgccagactacaaccagcctcccggatttggt
ggaacaaaccagggtaagaggcagacgtggtacaacagcacactggcgtccagaaggaaa
cggctgacggctcattttgaggacctggagcagtgctacttctccaacaagatgtcccac
atcacagaggaaagccggaacatgaaccagctggatgatttcatggagtgtctggccaag
ttcacccgctacaactccgtccgccccctggccaccctctcatacgccagcgacctctac
aatggctccagtatcgtttccagcatcgagttcgaccgggactgtgactactttgccatt
gctggcgtgaccaagaagatcaaggtgtttgagtacggcacagtgatccaggatgcagtt
gacatccactaccccgtcaacgaaatgacctgcaactccaaaatcagctgtatcagctgg
agcagctaccacaagaacctcctggccagcagcgactacgagggcaccgtcatcctgtgg
gacgggttcacgggccagaagtccaaagtctaccaggagcatgaaaaaagatgttggagt
gtcgacttcaatctaatggaccccaaactcctagcctcgggttctgacgatgctaaagtg
aagttgtggtccaccaacctggacaactcggtagccagcatcgaggccaaagctaacgtc
tgctgcgtgaagttcagccccacctccaggtatcacctggcctttggctgtgcagaccac
tgcgtccattactatgacctgcggaacaccaagcagcccatcatggtcttcaaaggtcac
aggaaggccgtgtcctacgccaagtttgtcagcggggaggaaattgtgtcggcccaatcc
ttgagtgaacacaactggcccctcctgggaccttccagagttccggcccatcgtggaaag
actcgtggacacttctacttctgtttggatcaaacggagatgctggcctggcttagttca
gaagatgacgtttacaggtcaacggacagtcagctaaagctgtggaacgtcagcaagcct
cactgtctgcgttccttcaagggtcacatcaacgagaagaactttgtgggtctggcttct
aatggagattatattgcctgtggcagtgaaaacaactccctgtatctttactacaaagga
ctttccaagacactgttaacgttcaagtttgacacagtcaaaagtgtcctggacaaggac
aagaaggaggacgacaccaacgagtttgtgagcgccgtctgctggagggcgctgcctgat
ggggaatctaatgtgctgatcgctgcaaacagtcaaggaacaattaaggtt

DBGET integrated database retrieval system