KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00032764G001
Entry
GSTEN00032764G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04010  MAPK signaling pathway
tng04020  Calcium signaling pathway
tng04144  Endocytosis
tng04510  Focal adhesion
tng04540  Gap junction
tng04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:tng00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    GSTEN00032764G001
   04020 Calcium signaling pathway
    GSTEN00032764G001
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    GSTEN00032764G001
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    GSTEN00032764G001
   04540 Gap junction
    GSTEN00032764G001
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    GSTEN00032764G001
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tng01001]
    GSTEN00032764G001
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:tng04090]
    GSTEN00032764G001
Enzymes [BR:tng01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     GSTEN00032764G001
Protein kinases [BR:tng01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   GSTEN00032764G001
CD molecules [BR:tng04090]
 Proteins
  GSTEN00032764G001
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 Herpes_gE V-set C2-set_2
Other DBs
NCBI-ProteinID: CAG10972
UniProt: Q4RKW0
LinkDB
Position
1
AA seq 1337 aa
MSAFYDNKMGFFGMLAPGQYQCETVVSGQVFRSDIYTVEDDSCGGRSDERDFSGSGCLHP
QCPTGHFPGQRHLRVFHHPPNERNGQSQLGGRHHLRGKLFCGAGPQRDSDHGVRQPAGGD
RVHHPHQCLPTPQSAVAKRRRNGLRELLYSHQNQPPRRKSSEELVVPLHTAFTLTCQGEA
TIAWDTPLDVPEKTQEDNSGLFVTTISVDTATAMHSGYYTCFYSRNDTDREDDMMQSAIY
VYVPDPDMPFVPSVVPFGNHVLSDHEEMEIQCRVSDPSANVTLINVDTQQPVPCVYDSKR
GALGIFTAGTYVCKALINGEEHYSEDGCCPSGGSGLHVELTAKRTVLLVGDTITVNCLAR
GSEILEDHWKYPGKVVRTRVAAQFHPDFVKFKVSVTHLPSVSQTNRAVKNVHENKKDQEI
LYTLTVPQASVKDTGIYSCSITDIVTNKSQTKQIAIRVYASEFMSIQPEFREYESAELDE
VSEFRAYISSFPTARVTWLKDGVPLSDVTAEISSSLRQLNETSYISVLTLIRAKEEDSGN
YTMRVENGDQSRTVGLILELPRLVHVAPLTHTILDSVAVPAVIVDLLDIHHGSATGQSVV
CITRGQPTPLVEWFVCKNIKSCTNDTSSWVPLPVNATEVTMDSRFDEDNNLETQVMFGHL
ESTLAVRCLARNEMAAVSREIKLVSTGPHPELTVAAAVLVLLVIVIISLIVLVVIWKQKP
RYEIRWRVIESVSPDGHEYIYVDPMQLPYDSRWEFPRDRLVLGRILGSGAFGKVVEGTAY
GLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNLLGACTKSGPIYII
TEYCFYGDLVNYLHKNRENFLNPKAEKNNKKELDIFGINPADESSRSYVILSFESKGDYM
DMKQADNTQYVPMLERSNTSKYSDLQGSNYDHPPSQKGSNDGEMDELLSDNVNEGLTTKD
LLSFTYQVAKGMEFLASKNCVHRDLAARNVLLSQGKIVKICDFGLARDIMHDNNYVSKGS
VSCPWAHTAITVEQKATVSRRMNTFSFVPQTFLPVKWMAPESIFDNLYTSLSDVWSYGIL
LWEIFSLGGTPYPGMIVDSSFYNKIKSGYRMSKPEHAPQDVYDMMMRCWNSEPEKRPSFL
GLSDTVASLLPSSYKRFELRQDDELALLLAIRRIFSLDCTVQLATPPGTTRFVTTWLLAF
LKSNRSLLLQHYERVNQEFLKSDHPAVTRVCMDNDDAYIGITYKNQGKLKDRESGFDEQR
LSSDSGYIIPLPDLDPISDEEYGKRNRHSSQTSEESAIETGSSSSTYAKREGETLEDITL
LDEMCLDCSDLVEDSFL
NT seq 4014 nt   +upstreamnt  +downstreamnt
atgtctgccttctacgacaacaagatgggcttttttggaatgctcgctccgggccagtac
cagtgtgagacggtggtgagcggccaggtgttcaggagtgacatttacacagtggaggat
gacagctgcggaggccgttcagatgaaagagacttttccggatcgggttgtctacatcct
cagtgtcccacaggccacttcccaggacagcggcacctacgagtgttccatcacccacct
aatgagcggaacggtcaaagtcagctgggtggccgtcaccatcttcgaggaaaactcttt
tgtggcgctggaccacagcgggattctgaccacggagttcgtcagcctgctggaggagac
agagttcaccatcctcatcagtgcctacccaccccccaaagtgcagtggctaaaagacgg
cgaaacggtctcagagaattactttattctcaccaaaaccagccacctcgaaggaaatcg
tcggaggagctggtggttcccctccacacggccttcaccttgacatgtcagggggaggca
acaatcgcctgggacacaccgctggacgtgccagagaagacgcaggaagacaacagcggc
ctctttgtcaccaccattagcgtggacaccgccaccgccatgcacagcggctactacacc
tgcttctacagcaggaacgacacagacagagaagacgacatgatgcagagcgccatctac
gtctacgtgccagatcccgacatgccctttgtcccttcggtggtgcccttcggcaaccac
gtcctgtctgaccacgaggagatggagatccagtgtcgcgtgtcagatcccagcgctaac
gtgacgctgatcaacgtcgacactcagcagcccgtgccctgcgtgtatgacagcaagagg
ggagctctgggcatattcacagcggggacgtacgtctgcaaggccctcatcaacggagag
gagcactacagcgaggacggttgttgcccgtcagggggctccgggctgcacgttgagctg
acggccaagcgtacggtcctgctggtgggggacaccatcacggtcaactgtttggctcgg
ggatcagagattttggaagaccactggaaatatccgggaaaagtggtaaggacacgagtc
gcagcacaattccatccagattttgtcaagtttaaagtttcagtcactcatcttccctcc
gtttcccagactaaccgtgccgttaagaatgttcacgagaacaaaaaggatcaggagatt
ctttacaccctgacagtcccgcaggcttcagtcaaggacacgggcatctactcgtgttcc
atcaccgacatagtaactaacaaaagtcagacgaagcagatcgcaattcgtgtttatgcg
agcgagttcatgtccatccagcctgagttcagggagtacgaatcggccgagctggatgag
gtcagtgagttcagggcctacatcagctccttcccaaccgctcgggtcacctggctcaag
gacggcgtcccgctcagcgacgtgacggcagagatttccagcagcctccgccagctcaac
gagaccagctacataagcgtcctgactttgatccgggccaaggaggaggacagtgggaac
tacaccatgcgagtggagaacggagaccagagtcgcaccgtcggactgatcctggagctg
cccagactcgttcacgttgctcctcttactcacaccatcctggactctgttgcagtgcct
gcagtcatcgtggacctgctggacatccaccatgggtcagctacaggccagtctgtggtg
tgcatcaccagaggtcagcccacgccgctggtggagtggttcgtctgcaagaacatcaaa
agctgcaccaacgacacctcttcctgggtgccgcttcccgtcaacgccaccgaggtcacc
atggactcgcgctttgacgaggacaacaacctggagacccaggtcatgtttggtcacctg
gagagcacgctggcggtgcgctgcctggccagaaatgagatggccgccgtcagcagggag
atcaaactggtgtccactggccctcatccagagctgactgtcgctgctgctgtgttggtg
ctcctggtcattgtcatcatctcactcattgtcttggttgtgatctggaaacagaaacca
cgttatgaaatccgctggagggttattgagtccgttagcccggatggacatgagtacatc
tatgtggatcccatgcagcttccctacgactccagatgggagttcccccgtgacagactt
gtgctcggccgtatcctgggctctggtgcctttggaaaagtcgttgagggcaccgcctac
ggtctcagccgctctcagcctgtcatgaaggtggcagtaaagatgctcaaaccgacagcg
cgctccagtgaaaaacaggccctgatgtctgagctgaagatcatgacccatctgggacca
cacctcaacattgttaacctgctgggagcgtgcaccaagtcaggccccatctacatcatt
actgagtactgtttctatggcgacctggtcaactacctgcacaagaaccgagagaacttt
ctcaacccgaaagctgagaagaacaacaagaaagagctggacatttttggaatcaaccct
gcagacgagagcagcaggagttatgtgatcctgtccttcgagagcaaaggcgactacatg
gacatgaagcaggccgacaacactcagtacgtgcccatgctggagagaagcaacacctcc
aagtactctgacctccagggctccaactacgaccacccaccctcgcagaaaggatcaaat
gacggtgagatggacgaactgctgtcagacaacgtgaacgagggtctcaccaccaaagac
ctgctgagctttacctaccaggtggccaaagggatggagttcctggcttctaaaaactgt
gtccaccgggatctggctgccaggaacgtcctgctctctcagggcaaaatagtgaagatc
tgcgactttggactggcccgagacatcatgcacgacaacaactacgtctccaaaggaagc
gtaagttgtccttgggcacatacggccatcactgttgaacagaaggcgactgttagccgg
cggatgaacactttttcctttgttccacagacgttcctgccggtgaagtggatggcaccg
gagagcatttttgacaacctgtacacctcgctcagcgacgtttggtcgtacggcatcctg
ctgtgggagattttctctttaggtggcacgccatacccaggaatgattgtggattcaagc
ttctataacaagatcaagagtggctacaggatgtccaaaccagagcacgctcctcaggat
gtgtatgacatgatgatgaggtgctggaacagcgaaccggagaagaggccctccttcctg
ggactcagcgacaccgtcgcctctttgctgccctccagctataagaggtttgagctgcgg
caagacgacgagctggctctgcttttagcaatccgtcggattttcagcttagattgcacc
gtccagctggcgacgccaccggggaccacacggtttgtaacaacatggctgctggcgttt
ctgaagtctaatcgaagtctgcttttgcagcattacgagagggtgaaccaggagttcctg
aagagcgaccaccctgccgtgaccagagtgtgcatggacaacgacgacgcgtacatcggc
atcacctacaaaaaccaggggaagttgaaggacagggaaagtggttttgatgagcagcga
ctgagctccgacagcggctacatcatcccgctgcctgacctggaccccatatctgacgag
gaatatgggaagaggaacagacacagctctcagacatctgaggagagcgccattgagacc
ggctccagcagctccacctacgcaaagcgtgagggtgagacgctggaggacatcacgcta
ttggacgagatgtgtctggactgtagcgacctggtggaggacagctttttgtga

DBGET integrated database retrieval system