KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00033767G001
Entry
GSTEN00033767G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K18496  fibroblast growth factor 1
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04010  MAPK signaling pathway
tng04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:tng00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    GSTEN00033767G001
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    GSTEN00033767G001
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:tng04052]
    GSTEN00033767G001
   00536 Glycosaminoglycan binding proteins [BR:tng00536]
    GSTEN00033767G001
Cytokines and growth factors [BR:tng04052]
 Growth factors
  Growth factors (RTK binding)
   GSTEN00033767G001
Glycosaminoglycan binding proteins [BR:tng00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   GSTEN00033767G001
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-ProteinID: CAG11711
UniProt: Q4RIS1
LinkDB
Position
7
AA seq 128 aa
MSLLLYSRNGGYHLRILPDGTVSGGRQENDPYDILRVKAVSAGVVVIQGEATGRYLAMDG
KGRLYGSQSLNDECGFLEKYEENHFNTYCSQKYGWYVGLKRSGQPKAGPSTHLAQKAVFF
LPRPVGDA
NT seq 387 nt   +upstreamnt  +downstreamnt
atgtccctgttgctgtacagccgcaacgggggttatcacctcaggattctcccggatgga
accgtgagtggcggcaggcaggaaaacgacccgtacgatatcctgagggtcaaggcggtg
agcgccggcgtggtggtcatccagggcgaggccacgggtcggtacctggccatggacggg
aaaggccgcctctacggctcgcaaagcctcaatgacgagtgtggcttcctggagaagtac
gaggagaatcacttcaacacttactgctcccagaagtacggctggtacgtggggctgaag
aggagcggccagcccaaagccggacccagcacccacctggctcagaaggccgtcttcttt
ctgcccaggcccgtgggcgacgcgtga

DBGET integrated database retrieval system