KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00035171G001Help
Entry
GSTEN00035171G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng00512  Mucin type O-glycan biosynthesis
tng01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tng00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    GSTEN00035171G001
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:tng01003]
    GSTEN00035171G001
Enzymes [BR:tng01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     GSTEN00035171G001
Glycosyltransferases [BR:tng01003]
 O-Glycan biosynthesis
  Mucin-type
   GSTEN00035171G001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin RicinB_lectin_2
Motif
Other DBs
NCBI-ProteinID: CAG12736
UniProt: Q4RFU6
LinkDB All DBs
Position
16
AA seq 611 aa AA seqDB search
MAFVFRRWRVLVVLNVLAIAGFMTFWAKCNTRTFQGGAEAAADGRRPRGNATAQGPSMSH
EVLLKRLSSLEDVVYRQLNGLSKSLGLIEGFGGRGKGGLPATLSPAEESEAGYLREKYGY
NAYLSDRISLDRTIPDHRPSKCRKVSYPRDLPRISLIFIFVNEALSVILRSVHSAVNHTP
AHLLKEIILVDDNSDDGEHPAETFKEQQLKGPLEEYVNKRYPGLVKIVRNQKREGLIRAR
IEGWKVASAEVTGFFDAHVEFTPSWAEPVLARIKEDYKRIILPSIDNIKHDTFEVERYEN
SGHGYNWELWCMYINPPKQWWEEGDASAPIRHDQTPAMIGCSFVANRDYFGELGLLDSGM
DVYGGENIELGIRVWLCGGSMEVLPCSRVAHIARVKKPYHSNIAYHTRRNALRVAEVWMD
QYKSNVYLAWNIPMESHGIDYGDISQRVALRKSLQCKSFEWYLDNVYPEMRRYNNTLFYG
EIRNSKVSHLCMDQGIKENHTATLHPCHGWGPQLGRYTKDGQLFLGPLGSTGEDTRCVVD
DQISSVPQLINCDRATDVKQMTWHFSQNESIVNQATGRCLEVVPANVYFGHLLILQPCTG
QRWSIKNTMRQ
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atggcttttgtcttcagaagatggagagttttagtggtgctgaacgtgctcgccatcgct
ggattcatgactttctgggccaagtgcaacacacgcaccttccaaggcggagcggaggct
gcggctgacggcaggaggccccgaggcaacgcgacggcgcagggacccagcatgagccat
gaggtgctgctgaagaggctcagctctctggaggatgtcgtctacaggcagctgaatggt
ctgtccaaatctctgggtctgatcgagggcttcgggggtcgaggtaaaggcggccttcct
gccactctgtctccggccgaggagagcgaggccggatacctgagagagaagtacggctac
aacgcgtacctcagcgacagaatctccctggaccggaccataccggaccaccggcccagc
aaatgcaggaaggtcagctatcccagagacctgccacggatctccctcatcttcatcttc
gtcaacgaggctctgtccgtgatactgcgctcagtccactcggctgtcaatcacacgccg
gcccacctgctcaaagaaatcatcctggtggacgacaacagcgacgacggtgagcatcct
gcagagaccttcaaagaacagcagctgaaagggcctctggaggagtatgtgaacaagcgc
taccccggcctggtgaagatcgtcagaaaccagaagagggagggactgatccgggccaga
atcgagggctggaaggtcgcatccgcagaggtgacgggttttttcgacgcccacgtcgag
ttcacgccgtcctgggccgagccggtcctggccagaattaaagaggactacaagaggata
attcttccctccattgacaacatcaagcacgacacgttcgaggtggagcgctacgagaac
tccggccacggctacaactgggagctgtggtgcatgtacatcaacccgcccaagcagtgg
tgggaggagggagacgcgtctgctcccatcaggcacgaccagactcctgccatgattggc
tgctccttcgtggccaatcgggactactttggcgagctcggcctgctggactcgggcatg
gacgtgtacggcggggagaacatcgaacttggcatcagggtgtggctctgtgggggcagc
atggaggtgctgccctgttccagggtggctcacatcgcccgggtgaagaagccgtaccac
agcaacatagcttaccacacccggcggaacgctctgcgcgtggccgaggtctggatggac
caatacaagtccaacgtctacctggcctggaacatcccgatggagagccacggtatcgat
tacggggacatctcccagagggtggctctgaggaagagcctgcagtgtaaaagctttgag
tggtacctggacaacgtttacccggagatgaggaggtacaacaacaccttgttctacggc
gagatccgcaactctaaagtgagccacctgtgtatggatcagggtataaaggagaaccac
acggccaccctgcacccctgccacggatggggaccccagctgggacgttacaccaaagat
ggacagctcttcttaggtccactgggaagcacgggggaagacactcgctgcgtagtggac
gatcagatcagcagcgtccctcagctcatcaactgcgacagggcgaccgacgtgaagcag
atgacgtggcatttttctcagaacgagtccatcgtaaatcaggccacgggtcgatgtctg
gaggtggtgccagctaacgtttactttggccacctgctgatcctgcagccctgcacaggc
caacggtggagcatcaagaacacgatgaggcag

DBGET integrated database retrieval system