KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00035277G001
Entry
GSTEN00035277G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K10142  metalloreductase STEAP3 [EC:1.16.1.-]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04115  p53 signaling pathway
tng04216  Ferroptosis
Brite
KEGG Orthology (KO) [BR:tng00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    GSTEN00035277G001
   04115 p53 signaling pathway
    GSTEN00035277G001
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tng04131]
    GSTEN00035277G001
Enzymes [BR:tng01000]
 1. Oxidoreductases
  1.16  Oxidizing metal ions
   1.16.1  With NAD+ or NADP+ as acceptor
    1.16.1.-  
     GSTEN00035277G001
Membrane trafficking [BR:tng04131]
 Exocytosis
  Others
   Others
    GSTEN00035277G001
SSDB
Motif
Pfam: F420_oxidored Ferric_reduct IlvN NAD_binding_2 2-Hacid_dh_C Shikimate_DH NAD_binding_10 TrkA_N 7tm_7
Other DBs
NCBI-ProteinID: CAG12826
UniProt: Q4RFK6
LinkDB
Position
3
AA seq 491 aa
MPDDMARPLIRGRGDKGGSRCLEASASDPDALVVGVVGTGDFSRSLARRLVASGYQVVVG
SRNPKRFMALFPEEVEVTSQMEAASQADLVFIAVFPEHHSTLAELKPALAGKTLVDVSNG
LRINLDGPSNAELLADMFPESAVVKGFNTISAWTLQVGPRDGSRQVFLCSNCSRAKSAVM
QLCRQMGFVPVDKGLLASSLEMENLPLYLFPSWRLPVLCTLALFFLFYLYNFIHEVLHPF
VKSGKSVFYKMPVEVVNVTLPSVALVMLSLVYLPGLLAAGLQLRLGTKYKRFPDWLDRWL
TRRKQLGLCSFLCAALHAIYSLSLPMRKSARYKLANVVFKQVKEGVQDSWVDEEVWRMEL
YLSAGIVALGLLSLLAITSLPSVADTVNWREFSFIQSTLGYCALAMATVHTLIFGWNRAF
DPAQYHFYLPPTFALVLILPLVVLLGRLVLLLPCLSGQLRRIRRGWEKTRHIRFTLPEDG
CHNGLEDISHV
NT seq 1473 nt   +upstreamnt  +downstreamnt
atgcctgacgacatggcgaggcctttaatccggggccgcggggataaggggggctccagg
tgcctcgaggcctccgcgtctgaccccgacgccctggtcgtcggcgtcgtgggcaccggc
gacttctcccgctcattagcgagaaggctggtggcctcgggttaccaagtggtggtgggg
agtcgcaaccccaaacgctttatggctctgttccccgaagaggttgaggtgacatcgcag
atggaagcagccagccaggctgatctggtcttcatcgccgttttccccgagcaccattcc
acgctggctgaactgaagccggcgctggctgggaagacgctggtagacgtgagcaacggc
ctgaggatcaacctggacgggccttcgaacgccgagctgctggctgacatgtttccagag
agcgctgtggtcaaaggcttcaacaccatatcggcttggacgctccaggtgggcccgcgg
gacggaagcaggcaggtatttctgtgcagcaactgcagcagagccaagagcgcagtcatg
cagctctgccgacaaatgggctttgtccctgtggacaagggcctcctcgcctcctctctg
gagatggaaaacctcccgctctatctgttcccctcgtggcgcctcccggtcctctgcacc
cttgctctgttcttcctcttctacctgtacaacttcatccacgaggtcctccaccccttc
gtgaagtcggggaagagtgtcttctacaagatgcccgttgaggtggtcaacgtcacgctc
ccttctgtggccctggtgatgctgtcgctggtctacctgcctggtttgctcgctgctggt
ctccagcttcggttaggcacaaagtacaagcgcttccccgactggctggaccgttggctg
acgcggagaaagcagctcgggctgtgcagcttcctgtgtgccgctctccacgcgatctac
agtttaagcctccccatgaggaaatctgcccgctacaaactggccaacgtggttttcaaa
caggtgaaggagggcgtgcaggattcctgggtggacgaggaggtgtggaggatggagctg
tacctctccgcgggcatcgttgccctgggtctgctgtccctgctggccatcacctcgctg
ccctctgtggccgacaccgtcaactggagggagttcagcttcatacaatccacgctgggt
tactgcgccttggccatggccaccgtccacacgctgatatttggatggaaccgtgccttt
gacccagcccagtaccacttttacctgccccctacctttgctctggtcctgatcctccct
cttgttgtcctgctgggccgcctggtccttctcctgccctgcctgtccggtcagctcaga
cggatccgccgcggctgggagaagacccgacacatccgcttcactctgccagaagacggc
tgccacaatgggctggaggacatcagccacgtg

DBGET integrated database retrieval system