KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00035332G001Help
Entry
GSTEN00035332G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng00020  Citrate cycle (TCA cycle)
tng00190  Oxidative phosphorylation
tng01100  Metabolic pathways
tng01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tng00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GSTEN00035332G001
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    GSTEN00035332G001
Enzymes [BR:tng01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     GSTEN00035332G001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO GIDA FAD_binding_3 Thi4
Motif
Other DBs
NCBI-ProteinID: CAG12868
UniProt: Q4RFG4
LinkDB All DBs
Position
8
AA seq 696 aa AA seqDB search
PAATVQGSRNFHFSIYGKKNNAKVSKDISTQYPVVDHEFDAVVVGAGGAGLRAAFGLSEA
GFNTACVTKLFPTRSHTVAAQGGINAALGNMEDDDWRWHFYDTVKGSDWLGDQDAIHYMT
EQAPQAVVELENFGMPFSRTEDGKIYQRAFGGQSLKYGKGGQAHRCCCVADRTGHSLLHT
LYGRSLRYDTTYFVEYFALDLLMENGECKGVIALCMEDGSIHRFRAQNTVIATGCAARRL
TAQKIHPLQLTFCDSCVFYPSRGYGRTYFSCTSAHTSTGDGNAMVTRAGLPCQDMEFVQF
HPTGIYGAGCLITEGCRGEGGILINSEGERFMERYAPNAKDLASRDVVSRSMTIEIREGR
GVGPEKDHVYLQLHHLPPQQLATRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPT
NYKGQVCETPTCSASMFFSGSLHSLFYSPPTRSSLIPMEPIRWFLVCMPVARRPVPASTA
LTDWGPTPFWTWWCSVEPARSPSPRNDKPGEQLSPLKPNAGEESVANLDKMRFSNGNLRT
SEIRLNMQKAMQSHAAVFRTGSVLKEGCDKMDAIYQTMGDIKTFDRGIVWNTDLVETLEL
QNLMLNAIQTIYSAEQRKESRGAHAREDFKDRVDEYDYSKPVQGQEKKPFEQHWRKHTMS
YVDPKTGKVTLQYRPVIDSSLNEQDCAHVPPAIRSY
NT seq 2091 nt NT seq  +upstreamnt  +downstreamnt
cctgcggccacagttcaaggttcgaggaactttcatttctccatctatggcaagaagaat
aacgccaaagtatctaaggatatctctacacagtacccagtagtggatcatgagtttgat
gccgttgtggtgggagccggaggagcaggactcagggcagcctttggtctgtcggaggct
ggcttcaacactgcctgcgtcaccaagctcttccccaccagatctcacactgtagctgcg
cagggtgggatcaacgccgctctggggaacatggaggacgatgactggaggtggcatttc
tatgacacggtgaaggggtccgattggctgggagaccaggatgctatccattacatgacg
gagcaggctccgcaggctgtagtagagctggagaactttggcatgcctttcagtcgtact
gaggatggtaagatctaccagcgggcctttggcggtcagagcctgaagtatggaaaaggg
ggccaggctcacagatgctgctgtgtagctgacaggacagggcactcgctgctgcatacg
ctttacggaaggtcacttcgttatgacaccacttactttgtggagtactttgccctggac
cttctgatggagaatggagagtgtaaaggagtgattgctctctgcatggaggacggatct
attcaccgtttcagagctcagaatacagtcatagccacggggtgcgctgctcgccggcta
acggcacagaagattcatcctcttcagctcactttttgtgacagctgtgttttctatccc
tccagaggttatggaagaacctatttcagctgcacgtctgcccacactagcaccggagat
ggaaacgccatggtgaccagggctggcctgccctgtcaggatatggagtttgtccagttc
caccctacaggcatctatggagccggttgtctgatcaccgagggttgtcgtggggaaggc
ggtatcctgatcaacagcgaaggagagcgtttcatggagcgctatgcccccaatgctaag
gacctggcctccagagatgtggtgtcccgctccatgacaatagagatcagagagggcagg
ggtgttggtccagaaaaggaccacgtgtatctccagctgcaccacctccctccccagcag
ctggccaccaggcttcccggcatctcagagactgccatgatctttgctggtgtcgacgtt
accaaggagcccatccccgtcctgcctactgttcattacaacatgggaggaatacccacg
aactataaaggacaggtatgtgaaacccccacgtgttctgcctccatgttcttcagcggg
agccttcactcattgttctactctcctcccaccaggtcatcactcataccaatggagccg
ataaggtggttcctggtctgtatgcctgtggcgaggcggcctgtgccagcgtccacggcg
ctaaccgactgggggccaactcccttctggacttggtggtgttcggtagagcctgcgcgc
tcaccatcgccgaggaacgacaagcctggggagcagctgtccccactgaagcccaacgct
ggagaggagtctgtggccaacctggacaagatgaggttctccaacggaaacctgagaacg
tcagagattaggctcaacatgcagaaggccatgcagtctcatgctgctgtgttccgtact
ggctcagtcctgaaggagggctgtgataagatggatgccatttaccagaccatgggtgac
atcaagaccttcgacagaggtatcgtgtggaacacagacctggtggaaactctggagctg
cagaacctgatgctgaacgccatccagaccatctactctgccgagcagaggaaggagagc
agaggagcccacgcaagagaggactttaaggatcgtgtagatgagtacgattactcaaag
cctgtgcaaggtcaggagaagaagccctttgagcagcactggaggaagcacactatgtcc
tacgtggaccccaagactggaaaggtgaccctgcagtaccgccctgttattgacagctct
ctgaacgaacaggactgcgcccacgtcccaccggccatccgctcctattag

DBGET integrated database retrieval system