KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00035854G001
Entry
GSTEN00035854G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K06643  E3 ubiquitin-protein ligase Mdm2 [EC:2.3.2.27]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04068  FoxO signaling pathway
tng04110  Cell cycle
tng04115  p53 signaling pathway
tng04120  Ubiquitin mediated proteolysis
tng04144  Endocytosis
tng04218  Cellular senescence
tng04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:tng00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    GSTEN00035854G001
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    GSTEN00035854G001
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    GSTEN00035854G001
  09143 Cell growth and death
   04110 Cell cycle
    GSTEN00035854G001
   04115 p53 signaling pathway
    GSTEN00035854G001
   04218 Cellular senescence
    GSTEN00035854G001
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    GSTEN00035854G001
Enzymes [BR:tng01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     GSTEN00035854G001
Membrane trafficking [BR:tng04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    GSTEN00035854G001
Ubiquitin system [BR:tng04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    GSTEN00035854G001
SSDB
Motif
Pfam: zf-C3HC4_3 SWIB DZR zf-FPG_IleRS
Other DBs
NCBI-ProteinID: CAG13283
UniProt: Q4RE99
LinkDB
Position
undetermined
AA seq 358 aa
VRPKVEFHSLLQHAGATKEVFTMKEVMFYLGQYIIQKQLYDQKQQHIVHCSHDELGRVLG
VDSFSVKEPRVLFAALMKNLVAVRNQDSPSSSDSKPEDQPEKPESTRSEVTTADPDSDSD
NFSVEFEVESDASDDYNEDDTWVSADDQVYEVTFEAEEEDSFDEDTEITEAVRKESDDYW
RCLKCDELNPPLPRNCQRCWALRCDWLPEATSKPASPSPKALPPKPDRQAAANEAAGSTP
SAADVSQDLCSSSQPSSSCSQTFSSSLDSQALLPATPVPESASATPELERSVSAEWRLPE
SRLDPCLICQSRPKNGCIVHGRTGHLTSCYVCARKLKKRNKMCPVCRMPIQSVIFTYL
NT seq 1074 nt   +upstreamnt  +downstreamnt
gtcagaccaaaagtggagtttcacagtttgcttcaacacgctggagccaccaaagaggtt
ttcaccatgaaggaggtgatgttctacctgggccagtacatcatccagaagcagctgtac
gaccagaagcagcagcacatcgtccactgctcccacgatgagctgggccgggttctgggc
gtggacagcttctccgtcaaagagccgcgagttttgtttgccgccctcatgaagaacctg
gtggctgtgaggaaccaagattcgcccagctccagcgattcaaagccagaggaccagccg
gagaagccggagtcgacgaggtcagaggtcaccaccgcagacccagactccgacagcgac
aacttcagcgtggagttcgaggtcgagtccgacgcctccgacgactacaacgaggacgac
acctgggtgtcggccgacgatcaggtctacgaggtgacctttgaggccgaggaggaagac
tcttttgatgaagacacggagatcacggaggctgtaagaaaagaatctgacgattactgg
cgctgcctcaagtgtgacgagttgaacccccccctgcccagaaactgccagcgctgctgg
gcgctgcgctgtgattggctcccggaggccacctccaaaccggcctcgccgagccccaaa
gcgctgcccccgaagccagacaggcaggcagcagcaaacgaagctgcaggctccaccccc
tctgctgctgatgtctcccaggatctttgctcatcctcacagccttcgtcctcctgctcg
cagaccttctcttcttctctcgactcacaggcgctcttaccagcaacccctgttcccgag
tcagcctccgccacccctgagctggagcgtagcgtgtcggcggagtggcggctgcccgag
tcccgcctggacccgtgtctcatatgtcagtcgcggccgaagaacggctgcatcgttcac
gggcgaactggacacctgacttcctgctatgtctgcgccaggaagctgaagaagaggaac
aagatgtgtccggtgtgcaggatgcccatccagtcggtcatcttcacctacctc

DBGET integrated database retrieval system