KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00035967G001
Entry
GSTEN00035967G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K06640  serine/threonine-protein kinase ATR [EC:2.7.11.1]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng03460  Fanconi anemia pathway
tng04110  Cell cycle
tng04115  p53 signaling pathway
tng04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:tng00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    GSTEN00035967G001
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    GSTEN00035967G001
   04115 p53 signaling pathway
    GSTEN00035967G001
   04218 Cellular senescence
    GSTEN00035967G001
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tng01001]
    GSTEN00035967G001
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:tng03400]
    GSTEN00035967G001
Enzymes [BR:tng01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     GSTEN00035967G001
Protein kinases [BR:tng01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   GSTEN00035967G001
DNA repair and recombination proteins [BR:tng03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    GSTEN00035967G001
SSDB
Motif
Pfam: PI3_PI4_kinase FAT UME FATC HEAT_2 HEAT TPR_14
Other DBs
NCBI-ProteinID: CAG13362
UniProt: Q4RE20
LinkDB
Position
10
AA seq 1959 aa
RLEDSSEQVKRELARVVGQLSCLQSDASHLGGIQSSSELLCQTISLASEHAETTIPSLGA
SFVKPFLPLLAQQSPSSVKQAFLDALPHLCLHVNLVSGDSDSRTVLSALFCLMEDSDLAV
RKCFSQSVRFLLMESEKNSGSSFLSEFLVARLKEAFDNAKVNRDDSLRNTLILTTGEIGR
ASQGSLVSFSLLRLLHCLLSKSSSVSVSAYTQIRALAAAKHLKLQTLFSQYKNPICQFLV
ESLHSRHMSALRSTPDQSGESAHQKELALDILAQIAHAFDFPDLNRFLNRTLQVLLPYLA
AKASSTSSALIRTLANELKVNRREILINNFKYIFSHLVCSCTKEELEKAFHYLQSETEIE
LGSLLRQDFQGLHNELLLRLGEHYQQVFNGLAILASFASNDDPYQGPKDITIPERMADYL
QPKLLGILAFFNMQLLSSSAGEKNRKKLALTSVMELMRLMGSKHISTVRVKMMTTLRTGL
RYREDFPLLCCQMWECFVKSVEPAHLGPLLSHVIVALLPLIPLQPKETAAIIRFLILHNR
EEVKDYLHEIYFLPDHPELRDIHSVLQDYKKVLTASSSDLAAALQLSMKAVQHENVDVRI
HALTSLRDMMHSNQEWLLQQVCASEAVEPVISNLVSVLLKGCQDSSPEARLLCGECLGEL
GAVDPGRLDLSRSHTNGDCYTFVSGVDDPNFAYDLLSELTRTFLAYADDVRAQDSAAYAI
QELLSIFDCREGRTDSPGRRLWRRFPEQIQEILEPHLNSRYKSSQKEVNWSKLKKPIYLS
KRGSRFSDWSATWARYLISKVRHELPSRVFACCSFIVKHDYKVTIYLLPHILLYMLLGCT
SAEQQEVTEEMLAVLTEGDGGGSGRSQETASSLSQLSIQTVFSMLSHLTQWSRHILYSKA
AKSDFSMSFFPESGEYQRVVAFLKGIPQDVLAKAALRSKAYTRALMHFEAYIIENKENIQ
DHLTFLQTLYAAMHEPDGVKGVNALRREEPSLREQILEHESIGLLRDATACYDRAIQLES
DQIGHYHGVMTSMLGLGQLSTVITQVNGVLASKHHWKSDLNTYRVEAAWKLGRWDLLEDY
LGSGNIILKNLLRSDAFVVQRYCFFYSLGSQSSTWGVQLGKLLLSAKKQDEGTFYQKLKL
VRKEQVVPLSAASYERGAGTYQRGYEYIVRLHMLSELEHTFTELQKQKEHSTPSLSQLPP
HWSDRLDMTQNSFRAKEPILALRRALLSLGPQPSRVELVGECWLQSARVARKAGHHQTAF
NALLNAENTHLAELVIERAKWLWAKGDVHQALIVLQKGVAQCFPDDEPLTNTRYLQTKGK
AMLLVGRFMEETANFESNAIMKVFKDVTNLLPEWEDGNFHLAKYYDKVMPMVTDNKLEKQ
GNLIRYIVLYFGKALQFGNQYIYQAMPRMLSLWLDFGARVCECEKTGRVDRQMRQEMGKI
NTVMMEHCDNLAPYQFLTAFSQLISRVCHSSNEVFTVLKTIVAKVFLAYPQQAMWLMTAV
SKSSYSMRMNRCNEILKKAISLKQSLEKFIGDTTRLTDKLLELCNKPVDGNSTTLSMSVH
FKQLKRLVEEPTFSQILIPLQSVLIPTLPSTGGANTKHDAFPGHWAYLDSFEDTVEILAS
LQKPKKISLMGSDGCSYTMMCKPKDDLRKDCRLMEFNCLINKCLRKDAESRRRELHIRTY
AVIPLNEECGIIEWVNNTAGLRHILTKLYKERGIYLSGKELRKLILPKTAPFEEKLRIHT
EVLCARHPPIFHEWFLRTFPDPTSWYSSRSAYCRSTAVMSMVGYILGLGDRHGENILFDS
FTGECVHVDFNCLFNKGETFDVPEVVPFRLTQNMVHAMGPMGTEGLFRQACEVTLRLMRD
QSEPLMSVLKTFLHDPLVEWSKQSKGLLKAQANETGEIVNEKAKTHVCDIEQRLQGVIKS
RNKVVGLPLSIEGHVHYLIQEATDDKLLCQMYLGWGPYL
NT seq 5880 nt   +upstreamnt  +downstreamnt
aggctggaggacagttcggagcaggtgaaaagggagcttgccagggttgtcggacagctg
agttgtctccagtcagacgcctctcacctcggtggaatccagtctagttctgagctcctc
tgccagacaatcagcctcgcatcagagcatgctgaaaccaccattccctccctcggggca
tcttttgtcaaacctttcttgccgctgctggcacagcaatcaccaagtagtgtgaaacag
gccttcctcgatgctttgcctcatctctgcctacacgtaaatcttgtcagtggagacagc
gactcccgcacagtcctcagtgctctgttttgtctgatggaggactctgatctggcagtc
aggaaatgtttcagccagtctgtgcgttttcttctcatggagagcgagaaaaactctggg
tcgagttttctgagtgagttcctggttgctcgcctgaaggaggcctttgacaatgctaaa
gtcaacagagatgacagcctgcgcaacactctcattctcaccacaggagagatcggcaga
gcatctcagggcagtttggtgtccttctctctgttgcggctgcttcactgtctgctgtcc
aagtcctcatcagtgtctgtgtctgcatacacgcagatcagagccctggctgcagccaaa
catctgaaacttcagacactcttcagtcagtacaagaaccctatatgccagttcctggtg
gagtcactacactcacgtcacatgtcggccttgcggagcacgcctgatcagagtggtgaa
tcagcccatcagaaagagctggccctggacatcctggctcagatcgctcatgcttttgat
ttcccggacctcaatcgctttcttaacaggactctccaggtgctccttccctacctggca
gccaaggctagctctactagctctgcgctcattcgcaccctggctaatgagctgaaggta
aacaggagggagatcctgatcaacaacttcaagtacatcttcagccatcttgtctgttcc
tgcacgaaggaggagctcgagaaagctttccactaccttcagagtgagacagaaattgag
ctgggctccctgttaaggcaggactttcaaggtctccacaacgagcttctgctgcgtctg
ggagaacactaccaacaggtgttcaatggtctggcaatcctggcttcctttgcatccaat
gatgacccataccaaggtcccaaagacatcactatcccagaacgcatggcggactacttg
cagcctaaactacttggaattcttgcctttttcaacatgcagttgctcagctccagcgca
ggagagaagaaccgcaagaagcttgcactgacaagtgtgatggaactaatgcgactgatg
ggatccaaacatatcagcacggttcgtgtcaagatgatgacaacgctccgcacaggcttg
agatacagggaggactttcctcttctctgttgtcagatgtgggagtgttttgtaaagagt
gtggagccagcgcatttggggcccctcttgagtcacgttattgttgcacttcttcccctg
atcccactgcaacccaaagaaaccgccgctattatccgcttcctgatactccacaacaga
gaggaagtcaaagactacctacatgagatttactttctgccagaccaccctgagctgaga
gacatccactctgttctgcaggactacaagaaggtgctgacagcaagcagtagtgacctg
gccgcagctctgcagctgtccatgaaggccgtccagcacgaaaacgtagacgtcaggatt
cacgcactgaccagtctcagggacatgatgcacagcaatcaggagtggcttctccagcag
gtgtgtgccagtgaggcggtggagccggtcatctccaacctggtgtcagtgctgctgaag
ggatgccaggactcgtccccagaggccagactactgtgtggggagtgtctgggagaactg
ggggctgtggatcctggacgcctggacctgtctcgctctcacaccaatggtgattgctac
acctttgtgagtggggttgacgatccgaactttgcctacgatctgctgtctgagctgacc
aggacttttctggcttatgctgatgacgtgagagcacaggactctgctgcttacgcaata
caggagttgctgtccatctttgactgccgcgagggccgtactgactcacctggccgccgt
ctatggaggagattcccagagcagattcaggaaatcctggaaccgcacctgaacagcagg
tataaaagcagtcagaaggaggtcaactggtctaaactgaagaagccaatatacttgagc
aagagaggcagtagattctctgactggtcagccacgtgggccagatatctcatcagtaag
gtgagacatgagctgcccagcagagtgttcgcctgctgtagtttcatcgtcaagcatgac
tacaaggtcacaatctaccttctacctcatatcctcctatacatgctgctgggctgcaca
tcagcagagcagcaggaggtaacagaggagatgctggcggtgttgacagaaggggacgga
ggagggagtgggcgcagtcaggaaacagcttctagcctttcgcagctcagtattcagact
gttttcagcatgctgtcccacctgacacagtggagccgccacatcctctactcaaaagct
gcaaaaagcgactttagcatgtccttttttccagagagtggagagtaccagcgtgttgtg
gcctttctgaaggggatcccacaggacgttcttgccaaagctgccctgcgatccaaagca
tatacgcgtgccctcatgcacttcgaggcgtacattatagaaaacaaggagaacatccag
gaccatcttacttttctacagacgctgtatgctgcgatgcacgaaccagatggtgttaag
ggggtcaacgctctgaggagggaggagccatcactacgggaacagatacttgaacacgag
agcatcggcctgctgagagatgcaactgcctgctatgatcgggccatacagctggagtca
gaccagatcggtcattaccacggggtgatgacctctatgctcggcctgggacagctgtcg
acagtcatcactcaggtcaatggtgtattggccagcaagcaccactggaagtcagaccta
aacacctacagagtggaagcagcctggaagcttgggcgatgggacctactggaagattat
ttaggctcaggtaatatcattttaaaaaacctgctgcgttctgatgcatttgtggtacag
aggtactgttttttttattctttaggaagtcagtccagtacctggggcgtacaacttggc
aagttacttctttcagctaagaaacaagacgaggggaccttttaccagaagttaaaactg
gtaaggaaagagcaagtcgtcccactttctgccgccagttatgagcgtggcgctggtacc
taccagagaggatacgaatacatcgtcagactccacatgcttagtgagctggaacacact
ttcactgagctgcagaagcagaaagagcactcaacccccagcctcagccagctgcctcct
cattggtccgaccgactggacatgacccaaaattcctttagagccaaagaaccaatcctg
gccctccgtcgtgccctgttgagcttgggaccacagccctcgagggtggagctggtaggg
gagtgctggctgcagagtgctcgggtggccagaaaggcggggcaccatcagaccgctttc
aacgcactactgaatgcagaaaacacacacctggcagagctggtcattgaaagggccaaa
tggctttgggctaagggtgatgtccaccaggccttaattgtccttcagaagggcgtggca
cagtgttttcctgacgatgagcctctgacaaacactcgctacctgcagactaaaggtaaa
gccatgttgctagttggacgttttatggaagagacggccaactttgaatccaacgccatc
atgaaggttttcaaggatgtgaccaaccttctacctgaatgggaggatggaaacttccac
ttagccaaatactacgacaaagtgatgccaatggtgactgacaataagctggagaaacag
gggaacctgatccgatacatagtcttatactttggaaaagccctgcagtttggaaaccag
tacatctaccaggccatgcctcgcatgctgtccctctggctggatttcggagcacgagtg
tgtgagtgtgagaaaactggacgtgtggacagacagatgcgccaggaaatggggaaaatc
aacaccgtgatgatggagcactgtgacaacctggcaccataccagttcctgacagccttc
tcccagcttatctccagagtgtgtcactccagcaacgaggtcttcaccgtcctcaagaca
attgtggccaaagtcttcctcgcgtacccacagcaggcgatgtggctcatgactgcggtg
tcgaagtcttcttatagcatgaggatgaatcgctgcaatgagattctcaagaaagccatc
agtctcaaacagtctctggagaaatttatcggggacaccacacgactaactgacaagctg
ctagagctctgcaacaagccggtggacggtaacagcaccaccctcagcatgagtgttcac
ttcaagcagctaaagcggctggtggaggagccgacgttcagccagatcctgatccctctg
cagtctgtcctcattcctacgcttccctctaccggcggggcaaacacaaagcacgacgct
ttcccaggacattgggcgtacctcgatagctttgaagacactgtggagattctggcctcc
ttgcagaagccaaagaaaataagtctaatgggttctgatgggtgtagctacactatgatg
tgtaaacctaaagatgacctaaggaaagactgcagactgatggagtttaactgcctcatt
aacaagtgccttcgtaaagatgctgaatcccggaggagggagctacatatccgcacgtac
gccgtcattcccctaaacgaggagtgcggaattatcgagtgggtcaacaacactgctgga
cttcgacacatactcaccaaattatataaagaacgaggaatctatctgtcaggcaaggag
ctcaggaaacttattttaccaaagacagccccttttgaggagaagttgcgcattcacacg
gaggtgctctgcgcccgacaccctcccatcttccatgagtggtttctccggaccttccct
gatcctacatcatggtacagcagtcgctctgcatactgccgatctactgctgtcatgtca
atggtgggttacatcctgggtctgggagatcgtcatggagaaaatatcctctttgattct
ttcacgggtgaatgtgtacatgttgacttcaactgcctcttcaacaagggggagacattt
gacgtacctgaggtggttccatttcgactgacccagaacatggtccacgccatggggccc
atgggcacagagggtctcttcagacaggcctgtgaggtcaccctgagactaatgagagac
cagagtgagccacttatgagtgtcctcaagacctttcttcatgaccctctggtggagtgg
agcaaacagtccaaaggacttttaaaagctcaggccaatgagacaggggagattgtcaat
gaaaaggctaaaacccacgtgtgcgacatcgagcagcgcctgcagggagtaataaagagc
aggaacaaagttgtgggtctgccattatcaatagagggacatgttcactatctcatacag
gaagccacagatgacaaactgctgtgtcagatgtatctgggctggggcccctacctgtag

DBGET integrated database retrieval system