KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00038441G001Help
Entry
GSTEN00038441G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04012  ErbB signaling pathway
tng04020  Calcium signaling pathway
tng04114  Oocyte meiosis
tng04217  Necroptosis
tng04261  Adrenergic signaling in cardiomyocytes
tng04310  Wnt signaling pathway
tng04912  GnRH signaling pathway
tng04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:tng00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    GSTEN00038441G001
   04310 Wnt signaling pathway
    GSTEN00038441G001
   04020 Calcium signaling pathway
    GSTEN00038441G001
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    GSTEN00038441G001
   04217 Necroptosis
    GSTEN00038441G001
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    GSTEN00038441G001
   04916 Melanogenesis
    GSTEN00038441G001
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    GSTEN00038441G001
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tng01001]
    GSTEN00038441G001
Enzymes [BR:tng01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     GSTEN00038441G001
Protein kinases [BR:tng01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   GSTEN00038441G001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CaMKII_AD DUF4440 SnoaL_3 SnoaL_2
Motif
Other DBs
NCBI-ProteinID: CAG14339
UniProt: Q4RB94
LinkDB All DBs
Position
undetermined
AA seq 135 aa AA seqDB search
VCVPAARKQEIIKITEQLIEAINNGDFDAYTRICDPGLTSFEPEALGNLVEGMDFHKFYF
ENRRSKNNKPGHTTRRNPHGHRSGEDAAGGADSRRTQCGDSAGRPRSSQWEETRVWHRRD
GKWLNVHFHCAGAPR
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
gtgtgtgtccctgcagctcgcaagcaggagatcatcaagataacagagcagctgatcgag
gccatcaacaacggggactttgatgcctacacgaggatctgcgaccccggactcacctcc
ttcgagcccgaggctctggggaacctggtggaggggatggacttccacaagttctacttt
gagaaccggcgcagcaagaacaacaagcccgggcacaccacccggcgcaacccccacggg
caccggagcggcgaggacgccgccggcggcgccgacagccgccgcacgcagtgtggggac
agcgcgggacgcccccgctccagccagtgggaggagacccgggtgtggcaccgccgcgac
ggcaagtggctcaacgtgcacttccactgcgcgggggccccgcgg

DBGET integrated database retrieval system