KEGG   Thioalkalivibrio nitratireducens: TVNIR_1350
Entry
TVNIR_1350        CDS       T02408                                 

Definition
(GenBank) hypothetical protein
  KO
K20370  phosphoenolpyruvate carboxykinase (diphosphate) [EC:4.1.1.38]
Organism
tni  Thioalkalivibrio nitratireducens
Pathway
tni00620  Pyruvate metabolism
tni01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tni00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    TVNIR_1350
Enzymes [BR:tni01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.38  phosphoenolpyruvate carboxykinase (diphosphate)
     TVNIR_1350
SSDB
Other DBs
NCBI-ProteinID: AGA33021
UniProt: L0DXD8
LinkDB
Position
complement(1306782..1310273)
AA seq 1163 aa
MDLVRMLGLGTSPADPEAERRKLQLYINLKLASSGQPTFLSGDMAEFLDTAQDLLKSYRE
KNRLLSQHHCPADRRVQDFLERYLEGLDPVPRLPTQSFILDRHGVARELSLPMDGDEFHS
EILSSYRVRQGVLHNPDKDRRTTEGSFHVAEGGLPIPGDKKAVPREAFGRLLAAALNPPD
DLLTLPFTASARRPARMFVSLLLRPTVCPEIPHQAAEKTMEIRFFAPGNLVSNLDFVESI
FGNGGNPYLPEFDAALDVEHWTGHTGCVILAPHLIHCTKKELGLPHWDQASERQREDGMC
WSEEQDLYNNGQAFKVTARDESGVIVTVVADNYYGYCKKEVKTQISFAANLYGLAEEEHA
GGALAFRRRNHGEEYGVDSRTREPGYTFDEMVERYGSVMDSQPEGYAIDRHHPEVIYVPQ
DLRMSLNAQTITWEQQGQTRTIRLEPGKIYMQPNGYKVEMLRHPGAPSWRLVGTDPEGTF
CHKPCTVSGGGKSEISKSIEDAVIFGPLFVDDLHKDLDRVQEIFDRDYSTRFRPGYEAED
HDPSRKPLSPQRSLGSVIKLLTPSKSYTDEFNQWLEAIPPRILALVFLIKRFYRQEWGND
WRHHLSVDEVDGAPGHELKLHGRRIIATYLRLGFDTEGKWRTFKVRQDYIAAEKVQMEDD
ISASVVVPAQCLTHPPQGDARQRSHKLVKNCEYRLFQRPDEAIHPGFDRQTEADLARPGN
FLANYEPLRGDALSAVTHDVLTLHNFTAPMRNLLLEAEAAGGYVVSSAHPRLVDGKPSKN
PRYLQTRPDLVHPVRRYVAEMGARFHRKLPLGEPLCLPVDAVLTGRRNNPPEPGIRPLAV
YNPIHYQELPELFMDFVCSLTGKSPSTTGAGSEGALTKGPFNALRPTADLNNALVSFILT
GYAGFSSSAGHIGPQVRVDHDVSLLIPEIWTRLHPQEREPGFMIENGYLEPLTDFEHKGQ
SVLASRLGYRITDRFVHDFLGKIFDNPSAVFTDAILRPETQDLDVFADGVANIVEAQQRV
ARRYLEDGCLDDACPPLKALLHIMAEGHYQGRDAHHPEIRAMFTRDYLLASDWYRERLEV
KQGRDAALWQRHADNLQHFLELESHADEAERLDIADRLRSARAKLAEVRSAAYLESLVGT
IGADPLGPARQTLELPEPQRQVA
NT seq 3492 nt   +upstreamnt  +downstreamnt
atggacctggtacgcatgctcggcctgggcacaagcccggccgatcccgaggcggagcgc
cgcaagctccagctctacatcaacctgaaactcgcctcctcggggcagccgacgttcctg
agcggggacatggcggagttcctggacacggcccaggatctgctgaagtcctaccgcgag
aagaaccgactgctgtcgcagcatcactgccccgcggaccggcgggtccaggacttcctg
gaacgctacctcgaagggcttgatccggtgccccggctaccgacgcagagcttcatcctg
gaccgccacggggtcgcccgcgaactgtcgctgccgatggacggcgacgagttccactcg
gagatcctgtcgagctaccgcgtgcgccagggcgtgctgcacaaccccgacaaggatcgg
cgcaccaccgagggatcgttccacgttgccgaaggcggactgccgatccccggggacaag
aaggccgtgccgcgagaggcattcgggcgcctgctcgcggcggcgctgaacccgccggac
gatctgctcacgctgccgttcaccgccagcgcgcggcggcccgcgcggatgttcgtatcg
ctgctgctgcgcccgaccgtctgtcccgagatcccgcaccaggccgccgagaaaacgatg
gagatccggttcttcgcgcctggcaacctggtcagcaacctggacttcgtcgagagcatc
ttcggcaacggcggcaatccgtacctgcccgagttcgacgccgcactcgatgtcgaacac
tggacgggccataccggctgcgtgatcctcgcaccacacctgatccactgcaccaagaag
gaactgggcctgccgcactgggaccaggccagcgagcgccagcgcgaagacggcatgtgc
tggagcgaggagcaggatctctacaacaatggccaggccttcaaggtcaccgcgcgcgac
gagagcggcgtgatcgtgaccgtggtggcggacaattactacggttactgcaagaaggaa
gtgaagacccagatcagcttcgccgcgaacctctacggccttgccgaggaagagcatgcc
ggtggcgcactcgcgtttcggcgccgcaatcacggcgaggaatacggcgtcgacagccgt
acccgcgaacccggctacaccttcgacgagatggtcgagcgctacggatccgtgatggat
tcgcagcccgaagggtacgccatcgatcgccaccaccccgaggtgatctacgtaccgcaa
gatctgcgcatgtccctgaacgcgcagaccatcacctgggaacaacagggccagacgcgt
accatccgactggagccgggcaagatctacatgcagccgaacggctacaaggtcgagatg
ctgcgccacccgggagcgccttcctggcgcctggtcggcaccgacccggaaggcactttt
tgccacaagccctgcacggtctccggcggcggcaaaagcgagatctccaagtcgatcgag
gacgcggtgatcttcggtccgctgttcgtcgacgacctgcacaaggatctcgaccgcgta
caggagatcttcgaccgcgactacagcacccgcttccgcccggggtacgaggccgaggac
cacgatcccagccgcaagccgctaagcccgcagcgcagcctcgggtcggtgatcaagctg
ctgaccccttcgaagagctacaccgacgagttcaaccagtggctcgaggccatccccccg
cgcattctcgcactggtgttcctgatcaagcgcttctaccgccaggaatggggtaacgac
tggcgccaccacctgtcggtcgacgaggtcgatggcgcccccggccacgaactgaagctg
cacggtcgccgcatcatcgccacctatctgcgcctgggcttcgacaccgagggcaaatgg
cgcacgttcaaggtccgccaggattacatcgcggcggagaaggtgcagatggaagacgac
atcagcgccagcgtggtcgtgcccgcgcagtgcctgacgcacccgccgcaaggagatgcc
cggcagcgcagccacaagctggtaaagaactgcgagtatcggctgttccaacgcccggac
gaggcgatccacccgggcttcgatcggcagaccgaggccgacctggcacggccggggaac
ttcctcgccaactacgagccgctgcgcggcgacgcgctgtcggcggtcacccacgacgtg
ctgacgttacacaatttcaccgccccgatgcgcaacctgctgctcgaggccgaggccgcc
ggcggctacgtggtgtcgtcggcccacccgcggctggtcgacggcaagccgtcgaaaaac
ccgcgctacctgcagacgcgcccggatctggtccatccggtccggcgctatgtcgccgag
atgggtgcccgcttccaccgcaagctgccgctcggcgaaccactgtgcctgccggtggac
gcggtgctcaccggccggcgcaacaatccccccgagccggggatccgtccgctcgcggtg
tacaacccgatccattaccaggaactgcccgagctgttcatggatttcgtctgctcgctg
accggcaagtcaccgtcgacgaccggtgctggcagcgaaggcgcgctcaccaagggccca
ttcaacgcgctgcgcccgaccgccgacctgaacaacgcgctggtgtcgttcatcctgacc
ggctacgccggcttctcgagctcggcgggacacatcggcccgcaggtgcgcgtcgatcac
gacgtcagcctgctgattccggagatctggacgcgcctgcatccgcaggaacgcgagccc
ggtttcatgatcgaaaacggctacctggaacccctgaccgatttcgaacacaaggggcag
agcgtgctggccagccgcctcggctaccggatcaccgaccgcttcgtgcacgacttcctc
ggcaagatcttcgacaatccgagcgcggtgttcaccgatgcgatcctgcgtccggaaacg
caggatctcgacgtattcgcggacggagtggccaatatcgtcgaagcacagcagcgggtc
gcacggcgctatctggaagacggctgcctggacgatgcctgcccgccgctcaaggccctg
ctgcacatcatggcagagggccattaccagggccgcgacgcgcaccacccggagatccgg
gcgatgttcacccgcgactacctgctcgcctcggactggtaccgcgagcgactggaagtg
aaacagggccgcgacgcagctctgtggcagcggcacgcggacaatcttcagcacttcctg
gaactcgaaagtcacgccgacgaggcggaacgtctcgacatcgcagaccgcctccgctcg
gcgcgcgcgaaacttgcggaggtacgcagcgccgcctatctggagagtctggtcggaacc
atcggcgcagacccgctcggccccgcgcgccaaacgctggaattgcccgagccgcagcgc
caggtagcctga

DBGET integrated database retrieval system