KEGG   Thioalkalivibrio nitratireducens: TVNIR_2610Help
Entry
TVNIR_2610        CDS       T02408                                 

Gene name
penA_[H]
Definition
(GenBank) Cell division protein FtsI (Peptidoglycan synthetase)
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
tni  Thioalkalivibrio nitratireducens
Pathway
tni00550  Peptidoglycan biosynthesis
tni01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:tni00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    TVNIR_2610 (penA_[H])
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    TVNIR_2610 (penA_[H])
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:tni01011]
    TVNIR_2610 (penA_[H])
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:tni03036]
    TVNIR_2610 (penA_[H])
Enzymes [BR:tni01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     TVNIR_2610 (penA_[H])
Peptidoglycan biosynthesis and degradation proteins [BR:tni01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   TVNIR_2610 (penA_[H])
Chromosome and associated proteins [BR:tni03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    TVNIR_2610 (penA_[H])
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: AGA34251
UniProt: L0E0S0
LinkDB All DBs
Position
complement(2702788..2704506)
Genome map
AA seq 572 aa AA seqDB search
MGALKRQVSHLRLKVVAAGLLVVVAVLVLRALDLQVLNRDFLQGQGEARQVRTVVEPAHR
GLITDRHGEPLAISGPVETAWAHPGELWADAERLPELARVLGLDPAALRNRVESRADREF
IYLRRHLPPEQAHQVAALQLPGVALMREFRRYYPHGETVAHIVGFTNIDEEGQEGMELAF
DGWLSGQPGAKRVLRDRHGRSIRDVASIRPARDGKDLRLTIDQRLQYLAYRELKAAVQAH
NARGGSAVLVDARSGDILALVNQPGFNPNNRSQMDLSQTRNRAATDSFEPGSVIKPFTVA
AALETGTVSPDVVLDTTPGTMRVGRHTVRDIRNFGRIDLATLISRSSNVGSTRLALETPP
GDFWRMLHQAGFGQSLGTGLPGEVTGLLRDYPTWRRVEVATLGYGYGLSVTPMHLVAAYT
AFANDGDRVPLRLVETAGDLRQPERVMRADTARAVLAMMERVTGSEGTARQAAIPGYRVA
GKTGTSRKAVAGGYSADTYVSAFVGLAPVSDPRFVMAVVVDEPDAGVYYGGAVAAPVFAR
VVEAALRLFHVAPDNLSEPPLRMALERGGPRS
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
gtgggcgcgctgaagcggcaggtcagccacctgcggttgaaggtcgtggcggcgggcctg
ctggtcgtcgtcgcggtcctggtgctgcgtgcgctggatctccaggtgctcaatcgcgac
tttctccagggtcagggcgaggcccggcaggtccgtaccgtggtggagccggcgcaccgc
gggctgatcaccgaccgtcacggcgagccgctcgcgatctccggcccagtggagactgcc
tgggcgcacccgggcgaattgtgggccgacgcggaacggctgccggagctggcacgcgtg
ctcggcctcgacccggcggcgctgcgcaaccgcgtggagtcccgggccgaccgggagttc
atctatctccggcgccacctcccaccggaacaggcgcaccaggtcgctgctctgcagctc
ccgggggtcgcgctgatgcgcgagttccggcgctactacccgcacggtgaaaccgtcgcg
cacatcgtcggtttcaccaacatcgacgaggaaggacaggaggggatggaactggccttc
gacggctggctgtcggggcagcccggcgccaagcgggtgctcagggaccgccatggacgg
agcatccgggacgtggcgagtatccgtccggcccgggatggtaaggatctgcgcctgacg
atcgaccagcgcctgcagtatctcgcctaccgggaactcaaggcggcggtgcaggcccac
aacgcgcgtggcggctcggcggtgctggtcgatgcccgctccggcgacattctcgcgctg
gtcaaccagccagggttcaatcccaacaaccgctcgcagatggacctgagccagacccgc
aaccgggccgcgaccgacagcttcgaaccggggtcggtgatcaagccgttcaccgtggcc
gcggccctggagacggggaccgtgagccccgacgtggtgctggacacgacccccggtacg
atgcgggtcgggcggcacacggtgcgcgacatccgcaacttcgggcgcatcgacctggcg
acgctgatctcgcgctcttccaacgtgggttcgacccggctcgccctggaaacgccgcct
ggtgacttctggcggatgctgcaccaggcagggttcggccagtcgctgggcacgggactg
cccggcgaggtcaccgggctgctacgggactacccgacctggcgccgggtggaagtcgcg
acgctcgggtatggctacgggctctcggtgactccgatgcaccttgtggccgcgtacacc
gcgttcgcgaacgatggcgaccgggtgccgctgcggctggtcgagaccgccggggacctg
cgccagccggagcgcgtgatgcgcgccgacactgcccgcgcggtgttggcgatgatggaa
cgcgtgaccgggagcgagggcactgcgcgccaggccgcgattcccggctaccgggtggcc
gggaagaccggcaccagccgcaaggccgtcgccggcggctactccgccgatacgtatgtc
tcggcgttcgtgggcctggcgccggtgtcggatccgcgtttcgtgatggccgtggtcgtc
gacgaacccgacgccggcgtctattacgggggcgcggtggcggccccggtctttgcgcgg
gtggtcgaggcggcactgcgcctgttccacgtggccccggacaacctgtccgaaccgccg
ctgcggatggctctcgagcgcggggggccgcggtcgtga

DBGET integrated database retrieval system