KEGG   Thioalkalivibrio nitratireducens: TVNIR_2684Help
Entry
TVNIR_2684        CDS       T02408                                 

Gene name
gatA_[H]
Definition
(GenBank) Aspartyl-tRNA(Asn) amidotransferase subunit A; Glutamyl-tRNA(Gln) amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
tni  Thioalkalivibrio nitratireducens
Pathway
tni00970  Aminoacyl-tRNA biosynthesis
tni01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tni00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    TVNIR_2684 (gatA_[H])
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:tni03029]
    TVNIR_2684 (gatA_[H])
Enzymes [BR:tni01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     TVNIR_2684 (gatA_[H])
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     TVNIR_2684 (gatA_[H])
Mitochondrial biogenesis [BR:tni03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    TVNIR_2684 (gatA_[H])
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AGA34325
UniProt: L0DZD2
LinkDB All DBs
Position
complement(2773271..2774725)
Genome map
AA seq 484 aa AA seqDB search
MTLDTLAGWARRLRARDISSRELTELYLQRVDRLDAQINSFITVTPEAALAAADAADRRL
ARGEQAALLGLPVAQKDIFCTRGVRTSCGSKMLDPFVAPFDATVVERMNAAGAVTLGKTN
MDEFAMGSSNETSFYGAVRNPWDADRVPGGSSGGSAAAVAARLVPGATGTDTGGSIRQPA
AFCGITGVKPTYGRVSRYGMIAFASSLDQGGPMAATAEDCAMMLNAMAGFDPRDSTSVER
PDEDFTAGLDANLKGLRIGLPNEFFGDGLDPSVRAATDAALAVLKDRGAELVEISLPNSG
LSVPAYYVVAPAECSSNLARYDGVRYGHRCAEPRDLTDLYTRSRAEGFGAEVKRRIMIGT
YVLSAGYYDAYYLKAQKVRRLIADDFRRAFERVDVIAGPTTPELPFCLGEKSADPVRMYL
SDIYTIAVNLAGLPGLSMPAGTVGCLPVGLQLIGNYFDESRLLGVAHQFQRDTDWHARMP
ASFV
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgacactcgatacccttgccggctgggcccggcgactgcgcgcgcgggacatcagcagc
cgcgaactgaccgaactctatctccagcgtgtcgatcggctggatgcgcagatcaacagc
tttatcaccgtcaccccggaggcggcgctggcagcggccgatgcggccgatcggcggctg
gccaggggcgaacaggcggcgctgctcggccttccggtggcccagaaggacattttctgc
acccgcggcgtgcgcaccagctgcggttccaagatgctggacccgttcgtcgcccccttt
gatgcgaccgtggtcgagcgcatgaacgccgccggcgcggtcacgctgggcaagaccaac
atggacgagttcgcgatggggtcgtcgaacgagaccagcttctacggcgcggtgcgcaat
ccctgggatgccgaccgggtgcccggcggttcgtccggcggttccgcggccgcggtcgcg
gcgcggctggtgccgggcgcgaccggcaccgacaccggcggctcgattcgccagccggcg
gcgttctgtggcatcaccggtgtcaagccgacctacggccgggtgtcgcgctacgggatg
atcgcgttcgcctccagtctcgaccagggcgggccgatggccgcgaccgccgaggactgc
gcgatgatgctgaacgcgatggcgggcttcgatccgcgcgattcgaccagcgtcgagcgc
ccggacgaggatttcaccgccgggctggacgcgaacctgaagggtctgcgtatcggcctg
ccgaacgagttcttcggcgatggcctggatccgtcggtgcgcgcggcgaccgacgccgcg
ctagcggtgctgaaggaccgcggcgcggaactcgtcgagatcagcctgccgaacagcggc
ctgtcggtgcccgcctactacgtggtggccccggccgagtgctcgtcgaacctagcccgc
tacgatggcgtgcgttacgggcatcgctgcgcggagccgcgcgacctgaccgatctctat
acccgctcgcgcgccgagggcttcggggcagaggtgaagcggcgcatcatgatcggcacc
tacgtgctttcggccgggtactacgacgcttattacctgaaggcccagaaggttcgcagg
ctgatcgcggacgatttccggcgtgcgttcgaacgggtcgacgtgatcgccggcccgacg
actccggagctgccgttttgcctcggcgagaagagtgcggacccggtcaggatgtacctt
tccgacatctacaccatcgcggtgaacctggccggtctgccgggcctgtcgatgccggcg
ggcacggtcggctgcctgccggtgggtctgcagttgatcggcaactacttcgacgaatcg
cggctgctgggggtcgcccaccagttccagcgggataccgactggcatgcgcgtatgccg
gcgtcgttcgtctag

DBGET integrated database retrieval system