KEGG   Thioalkalivibrio nitratireducens: TVNIR_2810Help
Entry
TVNIR_2810        CDS       T02408                                 

Gene name
ppc_[H]
Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
tni  Thioalkalivibrio nitratireducens
Pathway
tni00620  Pyruvate metabolism
tni00680  Methane metabolism
tni00710  Carbon fixation in photosynthetic organisms
tni01100  Metabolic pathways
tni01120  Microbial metabolism in diverse environments
tni01200  Carbon metabolism
Module
tni_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:tni00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    TVNIR_2810 (ppc_[H])
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    TVNIR_2810 (ppc_[H])
   00680 Methane metabolism
    TVNIR_2810 (ppc_[H])
Enzymes [BR:tni01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     TVNIR_2810 (ppc_[H])
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 Sec6
Motif
Other DBs
NCBI-ProteinID: AGA34448
UniProt: L0DZH9
LinkDB All DBs
Position
2901778..2904621
Genome map
AA seq 947 aa AA seqDB search
MTENRTDERFLPKDKELRARVRLFGELLGNVIRRLEGEAVLDAVEALRKGFVNLRKREDP
RLRERMMRCIVHQTPEMTERIIRAFSIYFSLVNIAEEDLFYRWRRAQVSSGEPLWTGSFD
RTLRQLHQEGVSAAELERLLSGLSYMPVFTAHPTEARRRTTMQNQRRVFQTADRLNQPRI
GGAERRLLIEELEAQIQILWRTNEVRVKKPQVRDEIKYGLFYFEESLFEAIPQTYRFLEK
AVRRTYGIQPDGSLPIRIPAFLRFGSWIGGDRDGNPNVTPEVTMLACRLAMQQVLREYIR
RVTHLRNVLTHSSLMCAPSAEFLASLKTDSSIAPAVFQGYMDRYETEPYRRKLQIMAYRL
KETLATVERRLAGESAVLPVMSAYAGADAFLADLRVIHDSLVSHGERNIAAGELTDLIRL
AETCGFHLHHLDVRQESTVHSAAVAAILAQTDLAADYETLDEPGRIALLSELIDRPDLPE
PDPERLDATARETLRVFEVIREMRVEVGPEGIGTYVISMTHAASHVLEVLFLGRLAGLAG
EASDGPFCHLRVTPLFETIEDLLHVEDVLEGLLATPTYARMLAASGNVQEVMLGYSDSCK
DGGILASSWNLYEAQKKIVAITERFGVRCQLFHGRGGTVGRGGGPTHESILAQPPATVQG
RIKFTEQGEVLSYKYSNVETAVYEIGVGATGLILASRSLIRAPARDRDEHMATMNELAGL
GEDAYRELVDRTPGVLDYFYESTPVQEIGFLNIGSRPSHRRKSDRSKTSIRAIPWVFGWA
QSRHTLPAWYGIGAALAAWRGEDPARLELLQQMYRDWPFFRSLLSNSQMALTKADMRMAA
DYAKLCSDQALAGQVFEKVREEYARTVREVLLVAQLDALMDETPLLALSLQRRNPYLDPL
NSIQIHLLRESRALEAGQPEGEETDNPWMSPLLRSINAIAAGMRNTG
NT seq 2844 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagaaccgtacagacgaacgctttctgcccaaggacaaggagctgcgcgcgcgg
gtccggctgtttggcgaactgctcgggaacgtgatccgccggctcgagggcgaagcggtg
ctggacgcggtcgaggccctgcgcaagggcttcgtgaacctgcgcaagcgcgaggatccg
aggctgcgcgaacgcatgatgcgctgcatcgtgcaccagacccccgagatgaccgagcgc
atcatccgggccttcagcatctatttcagcctggtcaacatcgccgaggaagatctcttc
taccgctggcgccgcgcccaggtgagcagcggcgaaccgctgtggaccggatcgttcgac
cgcaccctgcgccagttgcaccaggaaggggtctcggcggcggagctggaacggctgctg
tcggggctgagctacatgccggtattcaccgcgcacccgaccgaggcgcgccggcgcacc
acgatgcagaaccagcgccgcgtgttccagaccgcggaccggctcaaccagccgcgcatc
ggtggcgccgagcgccggctgctgatcgaggagctcgaggcacagatccagatcctctgg
cgtaccaacgaggtacgggtgaagaaaccgcaggtgcgcgacgagatcaagtacgggctg
ttctatttcgaggaaagcctgttcgaggccatcccgcagacgtaccgcttcctcgagaaa
gccgtgcggcgtacctacgggatccagccggacgggagcctgcccatccgcattcccgcg
ttcctgcgcttcggctcgtggatcggcggcgaccgcgacggcaacccgaacgtgaccccc
gaagtcacgatgctcgcgtgccggctggcgatgcagcaggtgctgcgggagtacatccgg
cgcgtgacccacctgcgcaacgtgctgacgcactcgtcgctgatgtgcgcgccctcggcc
gagttcctggcgagcctcaagaccgacagcagcatcgcgcccgcggtgttccaggggtac
atggaccgctacgaaaccgagccctaccgccgcaagctccagatcatggcgtaccgcctg
aaggaaacgctcgcgacggtggaacggcgcctggccggagagagcgcggtactgccggtg
atgtcggcctatgccggggccgacgccttcctcgcagacctgcgggtgatccacgactcg
ctggtcagccacggcgagcgcaacatcgccgccggcgaactgacggacctgatccgcctt
gccgagacctgcggctttcacctgcatcacctcgacgtacgtcaggaatcgaccgtgcac
agcgcggcggtcgcggccatcctggcccagaccgatctggccgccgactacgagacgctc
gacgagcccgggcggattgcgctgctgagcgaactcatcgaccggccggacctccccgaa
ccggatcccgaacggctcgatgccaccgcgcgcgaaaccctgcgcgtgttcgaggtgatt
cgcgagatgcgcgtggaggtcggccccgagggtatcggcacctatgtgatctcgatgacg
cacgccgcgtcgcacgtgctcgaggtgctttttctggggcgcctggccggactcgcgggc
gaagcgtcggacgggccgttctgccacctgcgggtcaccccgctgttcgagacgatcgag
gatctgctgcacgtcgaggacgtactcgagggcctgctcgccacgcccacctatgcacgc
atgctcgccgcgagcggcaacgtgcaggaggtgatgctcggctactccgattcctgcaag
gacggcggcatcctggcgtcgagctggaacctctacgaggcgcagaagaaaatcgtcgcg
atcactgagcgcttcggcgtgcgctgccagctgttccatggccgtggcggcaccgtgggt
cgcggcggcggcccgacccacgagtccatcctggcccagccgccggccacggtgcagggc
cggatcaagttcaccgaacagggcgaggtgctgtcgtacaagtatagcaacgtggaaaca
gccgtgtacgagatcggcgtcggcgccaccggcctgatcctcgcgagccgcagcttgatc
cgcgcgcccgcccgggaccgcgacgaacacatggcgacgatgaacgagctcgcagggctc
ggcgaggacgcctaccgggaactggtcgaccgcacccccggcgtgctcgattacttctac
gagagcacgccggtacaggagatcggttttctgaacatcggctcgcgcccctcgcaccgg
cgcaagagcgaccgttccaagacctcgatccgtgcgattccctgggttttcggctgggcc
cagtcgcgccacaccctgcccgcctggtacggcatcggggcggcgctggccgcctggcgc
ggcgaggatcccgcccggctggaactgctgcagcagatgtaccgcgactggccgtttttc
cggtcgttgctgtccaacagccagatggcgctgaccaaggccgacatgcgcatggccgcc
gactacgcgaaactctgcagcgaccaggcactggcggggcaggtcttcgagaaggtgcgc
gaggagtacgcgcgcacggtgcgcgaggtgctgctggtggctcagctcgatgcgctgatg
gacgaaacgccgctgctggccctgtcgctacagcgccgcaatccctacctggatccgctg
aacagcatccaaatccacctgctgcgcgagtcgcgggcgctggaggcggggcagccggaa
ggggaggaaaccgacaatccctggatgtcgccgctgctccgttcgatcaacgccatcgcg
gcgggaatgcgcaacaccgggtaa

DBGET integrated database retrieval system