KEGG   Thioalkalivibrio nitratireducens: TVNIR_2901
Entry
TVNIR_2901        CDS       T02408                                 

Gene name
ygdH_[H]
Definition
(GenBank) Decarboxylase family protein
  KO
K06966  pyrimidine/purine-5'-nucleotide nucleosidase [EC:3.2.2.10 3.2.2.-]
Organism
tni  Thioalkalivibrio nitratireducens
Pathway
tni00230  Purine metabolism
tni00240  Pyrimidine metabolism
tni01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tni00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    TVNIR_2901 (ygdH_[H])
   00240 Pyrimidine metabolism
    TVNIR_2901 (ygdH_[H])
Enzymes [BR:tni01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.10  pyrimidine-5'-nucleotide nucleosidase
     TVNIR_2901 (ygdH_[H])
    3.2.2.-  
     TVNIR_2901 (ygdH_[H])
SSDB
Motif
Pfam: DUF3412 DUF4478 Lysine_decarbox LDcluster4
Other DBs
NCBI-ProteinID: AGA34538
UniProt: L0DZR2
LinkDB
Position
2985285..2986685
AA seq 466 aa
MDDHTNTGTPVSGAKISTRVYPAGTLNMLSREEVARLSDATEEVGEVLRQCALAVLNSGE
QGDDAESMLRAYEDFRIQVHQVNRGMRIDLENAPACAFVDGKMIRGIRELLSAVVRDIVY
FHTEIGPNPYFDLAMPEGITNTVFEILRNARLLNAQREPNLVVCWGGHSISGEEYDYTKE
VGYQLGLRGRDICTGCGPGAMKGPMKGATIGHAKQRTLPGHYVGVSEPGIIAAEAPNPIV
NELVILPDIEKRLEAFVRLGHGIVVFPGGVGTAEEILFMLGILLNPANREAPFPLIFSGP
EAARGYFEEIDRFIGLTLGDRARELYRIVIDDPVAVAREMTRGIDQVREWRVHINDAFYF
NWLLDIQPSFQQPFEPSHAAMRSLEISRELQPHQLAANLRRAFSGIVSGNVKPQGVRAIR
EHGPFEIRGEADIMEALDQLLRRFVAQNRMKLPGGAAYEPCYRIVS
NT seq 1401 nt   +upstreamnt  +downstreamnt
atggacgatcatacaaatacaggtacgcccgtcagcggcgccaagatttcgacccgggtg
tatccggccgggacattgaacatgctctcgcgcgaggaagtcgcgcgcttgtcggatgca
accgaagaggttggagaagttctgcgtcagtgcgcgctggccgtgctcaactctggcgag
cagggcgatgatgccgaatccatgctgcgcgcctacgaggatttccgcatccaggtccac
caggtcaatcgcggcatgcgcatcgacctggaaaacgcgccggcctgcgcgtttgtcgac
ggcaagatgattcgcgggattcgcgagctgctgtcggccgtggtccgcgacatcgtctac
ttccacaccgagatcgggcccaacccctatttcgatctggccatgccggaaggcatcacc
aacaccgttttcgaaatcctgcgcaacgcccgcctgctcaacgcccagcgtgaacccaac
ctggtggtctgctggggcgggcactcgatcagcggtgaggagtacgactacaccaaggaa
gtcggctaccagctgggtctgcgcggccgcgacatctgcaccggctgcggaccaggagcg
atgaagggcccgatgaaaggagcgaccatcggccacgccaagcagcgcaccctgccgggc
cactatgtcggcgtctccgaaccggggatcatcgccgccgaggcgcccaacccgatcgtc
aacgagctggtcattctgcccgacatcgaaaagcgcctcgaggcctttgtccgcctgggc
cacggaatcgtcgtgttccctggcggcgtgggcacggccgaagagatcctgttcatgctc
ggcatcttgctgaatccggccaaccgcgaagcgccgtttccgctgatcttcagcggcccg
gaggcggcgcgcggctacttcgaggagatcgatcgattcatcggcctgaccctgggcgac
cgggcacgcgagctctaccgcatcgtcatcgatgatccggtcgccgtagcccgagagatg
acccgcggcatcgatcaggtccgggagtggcgtgtgcacatcaacgacgccttttatttc
aactggctgctggacatccagccgagtttccagcagcccttcgaacccagccatgcggcc
atgcggtcgctggaaatctcgcgcgagctgcagccgcaccagctcgcggccaacctgcgt
cgggccttttccggcatcgtctcgggcaacgtcaagccccagggcgtgcgcgccatccgt
gagcacggccccttcgagattcgcggcgaagccgacatcatggaagccctcgaccagctc
ctgcgtcgattcgtcgcccagaaccgcatgaaactccccggcggcgcggcctacgagcct
tgctatcggattgtcagctaa

DBGET integrated database retrieval system