KEGG   Trichoplusia ni (cabbage looper): 113494158Help
Entry
113494158         CDS       T05757                                 

Definition
(RefSeq) trypsin-6-like isoform X1
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
tnl  Trichoplusia ni (cabbage looper)
Pathway
tnl04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:tnl00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    113494158
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:tnl01002]
    113494158
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tnl04147]
    113494158
Enzymes [BR:tnl01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     113494158
Peptidases [BR:tnl01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   113494158
Exosome [BR:tnl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   113494158
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986
Motif
Other DBs
NCBI-GeneID: 113494158
NCBI-ProteinID: XP_026728154
LinkDB All DBs
Position
5
AA seq 385 aa AA seqDB search
MSMWGPLLLVLCACAVNGKLDEDEDQGSSGEHDLDDSTEKIGASISTIYQHPYAATLNSN
GTYVCSAIVLNTYWLLTLSKCFDAGIISSYVTHKNLGNFTVRAGSSYNNKGGNLYKIKML
INNFDLRVSAAKLESPMTFSSQVQNVKLPDADDDITLGFLASIIAWTPGGHMRLVNAPVI
DPSICEANTKMLPGHYVCVGGVQDPNRHFCRTLLLQRDNGGAVIQNDTLVAISSFINTCA
LYSKTHAFPKVASFVRWLDSIIWDEDVRPTTPEPPTTASGTKVLPNSTKGPNNQPYYADP
GKFMLTLPFDPINVPLEPAEDNSVLPRMSLYESYLQSLAKAKTSTTEDTSVPDQKTEPVQ
PYVKPVRPQQIYRRMPKKYDRYDYH
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgagtatgtgggggccgctgctgttggtcctatgtgcatgtgccgtgaacggaaagttg
gacgaagatgaagaccaagggtcctctggagagcatgacttggacgatagtacagagaag
atcggcgctagcatcagcactatctaccagcacccgtatgccgcgaccctcaacagcaac
ggcacctacgtctgcagtgccattgtgctcaacacgtactggctgctcacactctccaag
tgcttcgatgcagggattatatcatcatacgtgacgcacaagaacctcggaaacttcaca
gtcagggctggcagctcctacaataacaaaggcgggaacctctataagataaaaatgtta
ataaacaacttcgatctccgagtatcagctgcgaagctggaatctccgatgaccttcagc
tcacaagtacaaaacgtgaagcttccagatgctgatgatgacattactcttggattcctt
gcctctatcatcgcatggactcctggtggccacatgcggctagtcaacgctccggtcatc
gacccgtctatatgcgaggcgaacaccaagatgctaccagggcactatgtctgcgtagga
ggtgtgcaagaccccaacaggcacttctgcaggacgcttctcttacagagagacaacggc
ggcgctgtcatccaaaacgataccctcgtagccatctcctcattcatcaacacctgcgcc
ctctactccaagactcacgccttcccgaaggtggccagcttcgtccgttggctggactcc
atcatctgggacgaagacgtgaggccaacaacaccagaacctccaaccacagcatcagga
acaaaagtcttaccaaactcaactaaagggccaaacaaccaaccttattacgctgatccg
gggaaattcatgttaaccttaccttttgatccaatcaacgtgcctctagaaccagctgaa
gacaattctgtgttaccaaggatgagtctttacgagtcgtatctacagagtcttgcgaaa
gcaaagacgtcgacgacggaggacaccagtgttccggatcagaagaccgagccggtacag
ccttacgtcaagccagttagaccacaacagatttacaggcgaatgcctaagaaatacgac
cgttacgattatcattag

DBGET integrated database retrieval system