KEGG   Trichoplusia ni (cabbage looper): 113501255
Entry
113501255         CDS       T05757                                 

Definition
(RefSeq) bcl-2-related ovarian killer protein homolog A-like
  KO
K20017  Bcl-2 family protein
Organism
tnl  Trichoplusia ni (cabbage looper)
Pathway
tnl04214  Apoptosis - fly
tnl04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:tnl00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    113501255
   04215 Apoptosis - multiple species
    113501255
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 113501255
NCBI-ProteinID: XP_026738138
LinkDB
Position
15
AA seq 292 aa
MRRKRSTPLSALPGITDGLINLPNLRTSPTRTLSPLDRTKRRFSTMVSSAAAVAVSRRLS
ATIGWCLASPTQVKPQIVRQGRALCLQYIKTQIRRSSLCANKQIVMKRLQTMLETECGEE
AVSNSESGVLAGLRALCAALERKRPDAFRHVARQATRAPSAMLRSETALAELALALARRI
TRENITWSKIAAVYCVCGALAREAAEAADGEPALELVAAPAAALADLLHEDPGSWIASHG
GWNGLVDRLRASERDQRSEKTLRVMVSFFVLACLTLLLFRWVLHAHPAYNEL
NT seq 879 nt   +upstreamnt  +downstreamnt
atgcgccgaaaacggagcacgccgctcagcgcgctgcccggaatcacagatggactgatt
aatttaccaaatcttcgtacttcgccaacaaggacactgtcgccgttggatcggacgaag
cgtcgcttcagtacgatggtgtcaagtgcggcagctgtcgcagtgtcccggcggctctca
gcaactattggctggtgtctggcctcccccacacaagttaagccacaaatagtccgccaa
ggacgtgccctatgcttgcagtacataaaaacacagattagaagatcctctttatgtgct
aataagcaaatagtcatgaaacgcctacaaacaatgttggagactgaatgtggtgaagag
gctgtaagtaactccgagtctggagtgttggctgggcttcgggccctctgcgcagctttg
gaaaggaaaaggcctgatgcgttccgccatgttgcccgccaggcgacgcgcgcgccctcc
gctatgcttcgctcagagacagcactagcagaactagcacttgcactagcaaggcgcatc
actagagaaaacatcacgtggtcaaagatagcagctgtatactgcgtgtgtggtgcttta
gccagagaagcggcggaggctgcggatggtgagccagccttggagctggtggccgcacca
gctgccgcactcgccgacctactgcatgaggaccctggttcttggatcgcatctcatggc
ggatggaatgggttggtggatcgactgcgggccagtgagagggaccaacgttcggaaaag
acacttcgagtgatggtgtctttcttcgtgttagcctgtctaacactgttgctgttccga
tgggttctccacgcacatccagcttacaatgagttatag

DBGET integrated database retrieval system