KEGG   Trichoplusia ni (cabbage looper): 113502051Help
Entry
113502051         CDS       T05757                                 

Definition
(RefSeq) histone deacetylase 6 isoform X1
  KO
K11407  histone deacetylase 6 [EC:3.5.1.98]
Organism
tnl  Trichoplusia ni (cabbage looper)
Brite
KEGG Orthology (KO) [BR:tnl00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:tnl01009]
    113502051
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:tnl03019]
    113502051
   04131 Membrane trafficking [BR:tnl04131]
    113502051
   03036 Chromosome and associated proteins [BR:tnl03036]
    113502051
Enzymes [BR:tnl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     113502051
Protein phosphatases and associated proteins [BR:tnl01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     113502051
Messenger RNA biogenesis [BR:tnl03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     113502051
Membrane trafficking [BR:tnl04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    113502051
Chromosome and associated proteins [BR:tnl03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     113502051
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl zf-UBP zf-UBP_var ArfGap
Motif
Other DBs
NCBI-GeneID: 113502051
NCBI-ProteinID: XP_026739229
LinkDB All DBs
Position
16
AA seq 1128 aa AA seqDB search
MSTPPPPPPRRSSGESKKVTPPASSIVTRNGARKAKIQTRAMSAGAKPSALVVAAKRKAQ
QKKKHGIETELRDHYQIAMDSKTKVKGATGLVTEPRMAEHRCLWDDKYPECPERLTSIIE
RCHELNLIEQCKQFPPRAATKEELCVLHAPSVYDMMEKTHQNNDVEYLEQVSAKYDAIYI
HPTTHELALLAAGSTIDLVSRVVSGSIQNGLALVRPPGHHAMRAEPCGYCFYNNVALAAR
HATDTLGLTRILIVDWDVHHGQATQQMFYNDPRVVYFSIHRYEHGAFWPNLRQSNFHYVG
AGRGKGYNFNVPLNKTGMKDGDYLAIWHQLLLPMAFEYQPELIIISAGYDAAYGCPEGEM
ELTPACYAHLTSLLMSVSARVCVALEGGYCLQALADAAALTLRALLGHAAPSLEDVSEPS
DEIRDTILNCIYAQKPYWNCYNYQPTYSLSGPPNVSDVTRGRHVVSVKWEGDETRPDTFL
TRDCYPLQDDKTKAEIARRLNHLRIVTDLTLPQHPVGYIYDQAMLKHKNVCEPGHVECPE
RILRIHERHRDFGLLDRLHQLAPRTATDEEILTVHTEKHLNRLKELSTTKLRNLNKQKEE
FDSVYFHPDSLESAAVAVGCVLQMVDSVLSNECGSGVCVVRPPGHHADRWSPSGFCLLNA
AAAGASHALRARGLARVLLLDWDVHHGNGTQAITYHDNRILYMSIHRYDHGSFFPHSKDA
DHTAVGEGKGEGFNVNIPWNKRGMGDAEYLSAFTQVILPIAYEYNPELVIVSAGFDACVG
DPLGGCKVTPECFGRMTQLLRGLAGGRVILCLEGGYNITSISYSMTMCTKALLGDPIHHH
YDPKTPALWSAIDTIHDVINTHKQYWKSLKFQVALPTDYELETPLPSRGLIVDQTEFDIS
VSSIDLNDSTKSVSKSQLETSLETDLAKLTIGKKCSDGIHCGTDDEDETKTPKPPKPSEE
NTQATSSTPATKAGASSHKTCDKGGSSTPKATLVDYLAENMRAIADGDMFAVIPLQWCPH
LDSLFAIPSDVKFEQGVKCIDCEHTEENWVCLHCYITACARSINGHMQAHHVATGHALVL
SLVDLSVWCNVCDAYVDNALLYDAKNNAHKCKFGEDMPWCYKTDIHMQ
NT seq 3387 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaccccaccgccaccgccgcctcgtcgatcgtctggagagagtaaaaaggtgaca
ccacctgcatcaagtatagtgaccagaaatggtgctcgcaaggccaagatacagacccgc
gcgatgtccgccggggctaagccttcagctctagtagttgctgccaaacgcaaagcacag
cagaagaagaaacacggtatcgaaactgaattgagggatcattatcaaattgcgatggat
tccaagacaaaagtgaagggtgcgaccggtctggtgacggagccgcgcatggcggagcac
cgctgtctgtgggacgacaaatacccggagtgtcccgagagactcaccagcattatagaa
aggtgccatgaattaaacttaatagagcaatgcaaacagttcccaccacgagcggcgact
aaggaggagttatgtgtcttgcacgcgccctctgtgtacgacatgatggagaagacgcat
cagaacaatgatgttgagtatctggagcaggtctccgctaaatatgatgcgatttatata
cacccgactacccacgagctagccctgctagctgcgggctctacaatagacctagtttct
cgcgtagtgtcaggcagcatccagaatggcctggcgctggtgcgtccgcccggccaccac
gccatgcgcgccgagccctgcgggtactgcttctacaacaacgtggcgctggccgccagg
catgccaccgatacactcggcctgaccaggatactgattgtggattgggatgtgcatcac
ggacaagcgacacagcaaatgttttacaacgatcctagggtagtatacttctctatccac
cgctatgagcacggcgccttctggccgaacctccgccagtccaacttccactacgtgggc
gcgggccgggggaaggggtacaacttcaacgtacccctcaacaagaccggcatgaaagat
ggcgactatctcgctatatggcaccagctgttactgcccatggcttttgaatatcaaccg
gagctcatcataatatcagccggttacgacgctgcctacggctgtcctgagggcgagatg
gagctaacgcccgcttgctacgctcacctgaccagcctgctgatgtcggtgagcgcgcgc
gtgtgcgtggcgctggagggcggctactgcctgcaggcgctggccgacgccgccgcgctc
acgctgcgcgcgctgctgggacacgccgccccgagcctggaggacgtcagcgagcccagc
gatgagataagagacacgatcctaaactgcatatacgctcagaagccgtactggaactgc
tacaactaccagccgacgtactcgctgtcggggcctcccaacgtgagtgacgtcacgcgg
ggcaggcacgtggtctccgtgaagtgggagggagatgaaaccaggcctgacaccttcctc
accagggactgttacccgctgcaagacgataagactaaagctgagatagctcgccggctg
aaccatttgaggatagtgactgatttaacgctacctcaacacccagtgggctacatctac
gaccaagcaatgttgaaacataagaatgtctgtgaacccggtcacgtggagtgtccggag
cgtatcctacgcattcacgagcgccaccgagacttcggcctgctggacaggctgcaccag
ctcgcacccaggactgccactgatgaggagatactcactgtacacactgagaaacattta
aacaggttaaaagagctgtcaacaacgaaactaagaaacctcaacaaacagaaggaagag
ttcgactcggtgtacttccaccctgattctctagagagcgctgcggtagctgtggggtgt
gtcttacagatggtagactcagtgttatccaacgagtgcgggtctggcgtgtgcgtggtc
cggccgccgggccaccacgccgacaggtggtcgccgagcgggttctgcctgctgaacgcg
gcggcggcgggcgccagccacgcgctgcgggcgcgcggcctggcgcgcgtgctgctgctg
gactgggacgtgcatcacggcaacggcacgcaggccatcacctaccacgacaacaggatc
ctttacatgtctatacaccgctacgaccacggctcgttcttcccgcactcgaaggacgcg
gaccacacggccgtcggcgaagggaagggggaggggttcaatgttaacataccttggaat
aagcgtggcatgggcgacgcggagtacctgtcggccttcacgcaggtgatcctgccgatt
gcctacgagtacaacccggagctcgtcatcgtgtccgccgggttcgacgcctgcgtcggg
gacccgctcggaggttgcaaagtgacgccagaatgtttcggtagaatgacacagttactc
cgcgggctggcgggcggccgcgtcatcctgtgcctggaggggggctacaacatcaccagc
atctcctactccatgaccatgtgcacgaaggctctgctcggtgaccccatccaccaccac
tacgaccccaaaacccccgcactctggtccgccatagacacaatccatgacgtcatcaac
acacacaaacaatactggaaatcactcaaattccaagtcgcactaccaactgattacgaa
ctagaaactcccttaccatccagaggactcattgtagaccaaaccgaattcgatatatca
gtcagtagcatcgacctcaacgactcgacgaaatcagtatcaaagagccagttggaaaca
tcgttagaaactgatctcgctaagttgacgataggaaagaaatgttccgacgggattcac
tgcggtacagatgatgaggacgaaacaaaaacacctaaacctccaaaaccaagtgaagaa
aatactcaagcaacaagtagtacgccagctacgaaggcaggagcctcaagtcataaaacg
tgtgacaaaggaggttccagtacgccgaaagcgacattagtcgattacttggcggagaac
atgcgagcgatagccgacggcgatatgttcgccgtgattcctctgcagtggtgtccgcat
ttagactcgttgtttgcgataccgagtgacgtgaagttcgagcaaggtgttaaatgtatc
gactgtgaacatactgaagagaattgggtgtgcctgcattgttatataacggcatgtgcc
cgcagcattaacggccacatgcaagctcaccacgtagcgacaggccacgcgctagtgctg
tcgttagtcgatttgtcagtgtggtgcaacgtctgtgacgcatacgttgacaacgcgcta
ctctacgacgccaagaacaacgcgcataaatgcaagttcggggaagacatgccgtggtgc
tataagactgatatacatatgcaataa

DBGET integrated database retrieval system