KEGG   Trichoplusia ni (cabbage looper): 113504226Help
Entry
113504226         CDS       T05757                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial-like
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
tnl  Trichoplusia ni (cabbage looper)
Pathway
tnl00020  Citrate cycle (TCA cycle)
tnl00190  Oxidative phosphorylation
tnl01100  Metabolic pathways
tnl01200  Carbon metabolism
Module
tnl_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:tnl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    113504226
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    113504226
Enzymes [BR:tnl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     113504226
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 Pyr_redox_2 GIDA HI0933_like Lycopene_cycl NAD_binding_7
Motif
Other DBs
NCBI-GeneID: 113504226
NCBI-ProteinID: XP_026742203
LinkDB All DBs
Position
21
AA seq 639 aa AA seqDB search
MIVIAKKIGSLFFNKIGKRLPLKSSFRHGSYTIQHHQHDCVVIGAGGAGLRVSKGLAENK
FSVALISKLFPTRSHTIAAQGGMNAAIGSMHDDDWKFHFYDTVKGSDWLGDQDSIHYLTR
EAPGCVIELENMGMPFSRTKEGKIYQRPFGGGTINFGKSTAKRTCAVADRTGHALLHTLY
GYCTKYKNIDFFTEFFVLDLIVQDGEVVGCLAIDMDDGCLHRFQARNTVISTGGYPRMYF
SCTAAHTCTGDGCAMAARAGVPLQDLEFIQFHPTGMYGSGCLMTEGARGEGGYLVNSEGK
RFMEKYAPKAKDLASRDVVSRSMATEIRQGRGVGPKKDHVYLQLHHLSPELIKDKLPGIS
ESAFTFTGADVYTQPVPVLPTVHYTMGGIPINYRGEVLVHQGGKDCIVPGLYACGEAVSN
AHGANRLGANSLLDIVVFGKSIADTISADFKPGQKQPTLKDNLCDATIDNLEKMRCANGC
APPHELREAMRHTMQAKCGVFRDSKLLGEADVEIQKWFQAFADIRVVDRRFNWNTDLIEV
LELQNMLQLAVQVVACAKNRTESRGAHFRDDCPKRLDEYDYSKPVEGQTKKPMTEHWRKH
SLSVVDLCTGKVTITYRPVIDKTMDDSEVKWIPPVPRVY
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgattgtaattgcaaagaaaatcggcagtttatttttcaataaaatcggcaaaaggcta
ccgttaaaatcttcctttcgtcatggctcctacacgatccagcaccatcagcacgactgc
gtggttatcggcgcgggaggagcggggctgcgtgtctcaaaaggcctggctgagaacaag
ttctccgtagccctcatttccaagctgttccctaccaggtcgcacaccattgccgctcaa
ggcggtatgaacgccgctatcggaagtatgcatgatgatgactggaagtttcacttttac
gacacagtcaaaggatcagattggcttggtgatcaggattccatccactatttgacccga
gaagccccagggtgtgtcatagaattggaaaatatgggcatgccgttctcaagaacaaaa
gaaggaaaaatataccaaaggccgtttggtggtggaactattaacttcggaaagagtact
gccaagaggacatgtgccgttgctgatcgtactggccatgccctccttcacacgctttac
ggctattgcacgaaatataagaacatcgactttttcaccgagttctttgtgcttgatcta
atagtgcaggatggtgaggtagtgggatgccttgccatagacatggacgacggatgcctc
cacaggttccaagctaggaatacagttataagtactggaggctacccaaggatgtatttc
tcgtgtactgcggcccacacgtgcaccggcgacgggtgtgcgatggcggcgagagcaggt
gttccactgcaagacttggagtttatacagtttcatccaaccggcatgtacggatccggc
tgcttaatgacggaaggtgcccgcggagaaggcggctacctcgtgaacagtgaaggcaaa
aggtttatggagaaatacgcgcccaaagctaaagatttggccagtcgtgacgtagtatcc
agatcgatggccacggaaataagacaaggacgaggagtcggaccgaagaaggatcacgtg
tacctccaactccaccacctcagtcccgagttgatcaaggataagcttccagggatctcg
gaatctgccttcaccttcactggcgcagatgtgtatacgcagcccgtaccagtactgccc
actgtgcattacactatgggcggcatacctattaactacagaggagaggttttagttcac
caaggaggcaaggactgtattgtacctggactttatgcttgcggtgaggctgtcagcaat
gctcatggagccaacagattgggtgcaaactcactcttggatatcgtcgtcttcggcaaa
tctatcgcggacaccatcagcgccgacttcaagcctggccagaagcaacccactttgaag
gataacctctgcgatgccacgatagataatttagagaagatgaggtgtgccaatggttgt
gctcctccacatgaactgagagaagccatgaggcacacaatgcaggccaagtgtggagtc
ttcagagattccaaactattaggcgaagccgacgtagaaattcagaaatggttccaagcc
ttcgcagacatcagggtagtggacagacgcttcaattggaacacggacttgattgaggtc
ctggagttgcagaacatgctgcagttagctgttcaggtcgtggcgtgcgctaagaataga
actgaaagcagaggggcgcacttcagagacgattgtccgaagaggctggatgagtatgac
tacagtaagcccgtagagggacagacgaaaaaaccgatgacagaacactggaggaagcac
tcactgtccgttgtagatctatgtacggggaaagtaacgatcacctacaggccagtgatc
gacaagaccatggatgacagcgaggtgaaatggatccctcctgtgccgcgagtgtattaa

DBGET integrated database retrieval system