KEGG   Trichoplusia ni (cabbage looper): 113505045Help
Entry
113505045         CDS       T05757                                 

Definition
(RefSeq) ALK tyrosine kinase receptor-like
  KO
K05119  anaplastic lymphoma kinase [EC:2.7.10.1]
Organism
tnl  Trichoplusia ni (cabbage looper)
Brite
KEGG Orthology (KO) [BR:tnl00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tnl01001]
    113505045
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:tnl04090]
    113505045
Enzymes [BR:tnl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     113505045
Protein kinases [BR:tnl01001]
 Receptor tyrosine kinases (RTK)
  ALK family
   113505045
CD molecules [BR:tnl04090]
 Proteins
  113505045
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr MAM Pkinase Ldl_recept_a Pkinase_fungal SieB
Motif
Other DBs
NCBI-GeneID: 113505045
NCBI-ProteinID: XP_026743353
LinkDB All DBs
Position
24
AA seq 1810 aa AA seqDB search
MAFGKLVFVLVVVAVVVVGDHEIEKEDKAKKAMAAENHKYRSANPGKERGSFHKLSALMN
RTEDRRQGRRGDKVLRLSKKYNDMMNDNEGAIAINQKTSYDNDTVTLTDKMKILRPNGPM
YEAVNKYSYIPQATGVFCSFENNGTDSGSVCMWQWNSTVSSHGLGFKVVTAADVVAMNQT
TRGMKFSGPATDGDGDVGGHFLYLAVDPTMENMVIKSPPFRGLSEFCTFEAKFHQSKMQN
ASIKLVSESTTSEVQWIVQEVTGNNFEMWHTMRFMIGQIRQEVRIIMEISRPSYVSLSQT
LPHIAIDNIRMIDCVPEPVYGNGTCVPGLLNCKIMNIDSCIKLQQVCDLVKDCDDGSDEN
QGCDKMPFGSYCNFEQDTCGFENVPQPILQWTRHSGPTPTDKTGPNYDHTCGPTMPYDTM
MVPPLFPAHLNYTIAQCVGYYFFVNMNVTGPNKKKADFASTAVMRTVIFNPPPKVHGNIT
SRYYNCCMIRFYYQQNGRNYGSLSVNVVELTNRGNITTSVWFSTKNRGEVWYRASIFLPN
ITRRYFLEFKTRMGMRIYSDSAIDDFSMAPECFGINMDPEELGDYNYYDPVFEEKTTPHP
SFVDKPVYRFTTCGATGRFGPNQSMCDAAYNNTAVSVSVVHSPPYQGIQLWEVPAEGLYT
LIARGASGGLGSAWAGVSHAAQVRALVELHKSERVYVLVGQQGINACKKTLSAQEGQSEC
SRPSNESRPVFASRTHEVRNTHVTDGGGGGGGATYVFLLDKDGQAFPLLVAGGGGGISVG
SFRDDGSQHARPLTNATPESGYMYGEPGKTSGAGGGWLARAGPSTPGFELVRGAALHEGG
AGGAACAGRAHGGFGGGGGGCLRGGGGGGWLAKGKIGILLQNLSLNPNSFTKSVHTSVRL
LPSLYLLNCESYTIGIFNDYCSYYNAKKYPPSPSNIHSVINLMKNHFSLAFLYITLTIIK
YDLAQLFICIICSPGGNTNEGAGAHGGGGWSYIATRAVRDYSEASVAPHVGPGELLVLPA
IHDCDCDYRCVALNEYRSEVKCYCPATWTTDAHDPTKCILEDAWPRTPWVVIIVLSVAVF
VCALAVLCVCLYLYNTYQRKKEAEQQQKRLLEQDVQLQRLRSAPGGNDNLTMAFNPHYGS
ESILPQGIDVRGLPQVSRESLKLVKALGQGAFGEVYQGLYRHRTGDTVEMPVAVKTLPEL
STGQAESDFLMEAAIMAKFSHPNIVHLIGVCFDRHPRFIVLELLAGGDLKNFLRESRPKP
ERASALTMKDLLLCSIDVCKGCRYLESKRFIHRDIAARNCLLTSRGPGRVVKIADFGMAR
DIYRSDYYKKGGKAMLPIKWMPPEAYIDGVFTIKTDVWSFGVLLWEVFSLGVMPYTGCAN
REVMEMVSGGGRLEKPYGCPQEIYRLMCECWNPTPSERPSFAHMYERMQRFVQDPAIVSA
PLPIVRSLLPPHTEVQTSANGPQRAPACDYLVPMSPQENPTANNSPTEPLVLHSKSPTVA
QEPETEDSQYPPPVKASQGYGNLPTVQRSSGSVTRRDASATSAAETKTSTKFLQSNSTDR
LLSSVEGPSMDDEVVSDADDKPVIWETSFTEPPRNATPRQSIDNGPAVEKLISITPTSPK
PPENVLSKAIEANVIDKTNHKNALVPDRKTAPIASPDPPRINAWASESVKYTPKPKPLCL
DAAQLEQNLNALKKNSGSVNLTTMNILPPYINVVTPNKLSESKTIQIDPKKAVIDDLPKE
IEPKEEKGKLKQSNSAASLLNGPMTDVPYADSDNASSSSSSNQGKKFDDRNIVIKQGSNG
EFVGDSEISC
NT seq 5433 nt NT seq  +upstreamnt  +downstreamnt
atggcgtttgggaagttggtctttgtgctggtcgtggttgccgtcgtcgtggtcggcgac
catgagatcgagaaggaggacaaagcgaagaaagccatggcggcggagaaccacaagtac
cggagcgcgaacccgggcaaggagcggggctccttccacaagctgagcgcgctcatgaac
cgcacggaggaccggcggcagggccggcgcggggacaaggtgctgcggctcagcaagaag
tacaacgacatgatgaacgacaacgagggagccatcgccatcaaccagaagacctcgtac
gacaacgacacggttacattaaccgataagatgaagatccttcgtcctaacggtccgatg
tacgaggctgtcaacaagtactcgtacatcccgcaggctacaggggtgttctgcagcttc
gagaacaacggcacggactcggggagcgtgtgcatgtggcaatggaactccacggtgtct
agccacgggctcggcttcaaggtggtgacggccgctgatgtggtggccatgaaccagacc
actagaggaatgaagttctccggacccgcgacagatggggacggcgacgtgggaggtcac
ttcctgtacctagccgtggatcccacgatggagaacatggtgatcaaatcaccaccgttc
agaggactgtcagagttttgtacgttcgaagcgaagttccatcagagcaagatgcagaac
gcgagcataaagcttgtatcggagtccaccacgtcagaggtgcagtggatagtccaagag
gttaccgggaataacttcgaaatgtggcatactatgcgtttcatgatcggtcagattcgc
caagaagtccgcatcatcatggagataagtcgtccgagctacgtgagcctctcgcagact
ctcccgcatatagccatcgacaacataaggatgatagactgcgtgccagagcccgtgtac
gggaacggtacttgtgtacctggcctgttgaattgtaaaattatgaacattgattcgtgc
atcaaactacagcaagtctgcgatctggtgaaggattgcgatgatgggagcgatgaaaac
caaggctgcgacaaaatgccgtttggatcttactgcaattttgagcaggacacttgtgga
tttgaaaacgtgccacaaccgatcctccaatggactcgccacagtggtccaacacctaca
gacaaaactggtcccaattacgaccacacctgcggccccaccatgccatatgacaccatg
atggtcccgccattattcccggcacatcttaactataccatcgcacagtgcgtcgggtat
tacttctttgtgaatatgaatgtgactggtcctaataagaagaaagcggattttgcgtcg
acagctgtaatgcggacagtgatcttcaacccgcccccaaaagtccacgggaatattaca
tctagatattataattgttgtatgatcagattctactaccaacagaacggccgcaactac
ggctctctcagcgtcaatgtggtagaactgacgaacagagggaacatcaccacttcggtc
tggttctctaccaagaatagaggggaggtgtggtacagagcctccatcttcctgccgaat
attactagaagatacttcttagagttcaagactcgcatgggcatgcggatttactcggac
tctgctattgatgacttctcaatggctccggagtgtttcgggatcaacatggaccctgag
gagctcggggactacaattattacgatcctgtgtttgaagagaagaccacaccacatccc
tcctttgtcgataaacctgtataccgcttcacaacatgcggtgctacgggccgcttcggt
ccgaaccagtcgatgtgcgacgcggcgtacaacaacaccgcggtcagtgtcagcgtggtg
cacagcccgccgtaccaggggatacagctgtgggaggtgccagcagaagggctctacacc
ctgatagctcgcggtgccagcggcgggctgggctccgcgtgggcgggagtgtcgcacgcg
gcgcaagtgcgcgcgctggtcgagctgcacaagagcgagcgggtctacgtgctggtcgga
cagcaggggatcaacgcgtgtaagaagacgctatcggcacaagagggccaaagcgagtgc
tcgcggccgagcaacgagagccggccggtgttcgcgagccgcacgcacgaggtgcgcaac
acgcacgtcacggacggcggcgggggcggagggggcgccacctatgtcttcctgttggat
aaagacgggcaagcgttccccctgctggtggcggggggagggggcgggatctccgtgggc
agcttccgggatgacggctcgcagcacgcgcgcccgctgaccaacgctacgccggagtcc
gggtatatgtatggagagcccgggaagacttcaggtgcgggcggcggctggctggcgcgc
gcgggccccagcacgccgggcttcgagctggtgcggggcgcggcgctgcacgagggcggc
gcggggggcgcggcctgcgccggccgcgcgcacggcggcttcggcggcggcggcgggggc
tgtctgcgcggagggggaggagggggctggctggcaaagggtaaaatcggaatccttcta
caaaacctctcgcttaatcctaattcttttactaagtctgttcatacgtccgtacgtctt
ttacctagcttgtatcttttgaactgtgaaagctatacaattggaattttcaatgactac
tgtagctattataacgcaaaaaaatatccaccatcaccatccaacatccattcggtcata
aatctgatgaaaaaccatttctctttagcctttttgtacataactcttacaataatcaag
tacgacttagcccagcttttcatatgtatcatatgttcaccaggcggcaacacgaacgag
ggcgcgggcgcgcacggcggcggcggctggtcgtacatcgcgacgcgtgcggtgcgcgac
tacagcgaggcctccgtggcgccccacgtggggcccggggagctgctcgtgctgcccgcc
atacacgactgcgactgcgactatcgctgcgtggcactgaacgagtaccgctctgaagtg
aagtgctactgccccgccacctggaccacggacgctcacgaccccaccaagtgtatactt
gaagacgcctggccccgcaccccttgggtggtgataatagtgttgtctgtcgccgtgttt
gtctgcgcgttggctgtactgtgtgtctgcttgtatctctacaacacctaccaacgcaag
aaagaagcagaacagcaacaaaagcgtcttctagaacaagatgttcagcttcagcgtctc
cgcagcgccccgggtggtaatgacaacctgaccatggctttcaaccctcactatggaagt
gagagcatattgccgcaagggatcgatgtgaggggcctgcctcaggtgtctagggagagt
ctgaagcttgtcaaggctctcggtcagggtgcttttggagaagtctaccaaggtctctac
cggcaccggaccggggatacggtagaaatgccggtagctgtcaaaacactaccggaactg
tcgaccggccaggccgagtccgacttcctcatggaggcagctataatggccaagttcagt
catccgaacatcgtgcatcttatcggcgtttgctttgatcgacatccgaggttcatagtc
ctggaactgctagctggtggtgacctgaagaacttcctccgcgagagccgccccaagccg
gagcgagcgagcgcgctcaccatgaaggatctgcttctctgctctatagacgtctgcaag
ggatgccggtatctggaaagcaagaggtttatacacagggacatagcagcccgcaactgc
ttgctaacatcccggggcccaggacgagtggtgaagatcgcggacttcggcatggcgcgg
gacatctaccgctctgactactacaagaagggcgggaaggccatgctgcccatcaagtgg
atgccgccagaagcctatatagatggcgtgttcaccatcaaaactgatgtctggtcattc
ggcgtgctgctgtgggaggtgttctctttgggcgtgatgccgtacaccggctgcgcgaac
agagaggtcatggagatggtctccggcggcggccgcctcgagaaaccatatggatgtcca
caagagatctacaggctgatgtgcgagtgctggaacccgacgcccagtgagcgaccgtct
ttcgcgcacatgtacgagcgtatgcagcgatttgttcaggacccagccatagtaagcgcg
cctctcccaatagtccggtctttgctgccgccgcacacggaggttcagaccagcgccaac
ggcccgcagcgagcgccggcgtgcgactacctcgtcccgatgtcaccgcaggagaacccg
acggcgaacaatagcccaacggaaccgctggtccttcatagcaaatcgccaacggtggca
caggaaccagaaacggaggattcacaatatccacctcctgtgaaagcatcacaaggctat
ggcaacttaccaactgtccagcgaagcagcggaagcgtaacaaggcgcgatgcctccgct
acctccgccgcagagacaaagacaagcacaaagtttctgcagtctaactcaacggacagg
ttgctaagttcagtagaaggtccctcaatggacgacgaggtagtttcggatgccgacgac
aagccagtcatatgggagacatcgttcacggaaccgccacgcaacgctacgccgcgacag
agcatcgataatggaccagcagtcgagaaactgataagcattaccccaacctcaccgaag
ccgcctgaaaacgttctgtcgaaagccatagaagcaaacgtgatagacaagacgaaccac
aagaacgcactagtaccggaccggaaaaccgcacccatcgcctccccagacccaccgcgg
ataaacgcctgggcctcagaaagcgtcaaatatactccaaaaccaaaacctctttgctta
gacgccgcccaactcgaacagaatctaaacgcattaaaaaaaaacagcggatctgtcaac
ttgacaaccatgaacattttgccgccatacataaacgtagtgacgccaaacaagttatca
gaatcgaaaacgattcaaatcgatccgaagaaagcggtaattgacgatttgccgaaagaa
attgaaccaaaagaggagaaggggaagttaaaacagtcgaattcagcggctagcttgctc
aacggaccgatgactgatgtgccgtacgcggacagtgataacgcttcttcaagctcgagc
agcaaccagggcaagaagtttgacgataggaatatagtgatcaaacagggtagcaatggc
gagttcgtcggggattccgaaattagctgttaa

DBGET integrated database retrieval system