KEGG   Trichoplusia ni (cabbage looper): 113506154
Entry
113506154         CDS       T05757                                 

Definition
(RefSeq) tumor necrosis factor receptor superfamily member wengen-like
  KO
K16679  wengen
Organism
tnl  Trichoplusia ni (cabbage looper)
Pathway
tnl04013  MAPK signaling pathway - fly
tnl04214  Apoptosis - fly
tnl04215  Apoptosis - multiple species
tnl04391  Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:tnl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    113506154
   04391 Hippo signaling pathway - fly
    113506154
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    113506154
   04215 Apoptosis - multiple species
    113506154
SSDB
Motif
Pfam: TNFR_c6
Other DBs
NCBI-GeneID: 113506154
NCBI-ProteinID: XP_026744806
LinkDB
Position
2
AA seq 173 aa
MSVSKEVMRGDISKLCWLVATLALGSVWGGEACERGSSWWDRQRGICVPCTRCDPAKRLV
VRYPCEIHRDTICQSLYEAQISPFNTPKQVHKKDNESSELVPSDYEYEYVDYDSEVTPSN
DEVTWDLQTTSLSLAASGCIVFFVVVLVMSLYHARQWKVIKKALKSGVESHPI
NT seq 522 nt   +upstreamnt  +downstreamnt
atgagtgtaagcaaggaggtaatgcgaggagacataagcaagttgtgttggctggttgct
acactggctctgggctccgtgtggggaggcgaggcgtgcgagcgcggctcgagctggtgg
gaccggcagcgcggcatctgtgtcccatgcacccgctgcgaccccgccaaacgactggta
gtcagatacccgtgtgaaatccaccgggacactatctgccagtcgctttatgaagcccaa
atctcccccttcaatacacctaagcaggtgcataaaaaagacaatgaatcgagtgaactg
gtacccagtgattacgagtacgaatatgtggactacgatagtgaagtgactcctagtaac
gatgaagtgacgtgggacctgcagacgaccagcctcagtctggccgcgagtggatgcatc
gtgttctttgtcgtggtgctcgtcatgtcgctgtaccatgcgaggcagtggaaggttatt
aagaaggcgctaaagtcaggtgtggaatctcatcctatttaa

DBGET integrated database retrieval system